Conserved Protein Domain Family
PRK12480

?
PRK12480: PRK12480 
D-lactate dehydrogenase; Provisional
Statistics
?
PSSM-Id: 183550
View PSSM: PRK12480
Aligned: 19 rows
Threshold Bit Score: 626.555
Threshold Setting Gi: 88196464
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49484727    1 MTKIMFFGTRDYEKEMALNWGKKNNVEVTTSKELLSSATVDQLKDYDGVTTMQFGKLENDVYPKLESYGIKQIAQRTAGF 80
gi 70725546    1 MTKIMFYGTRDYEKNDALNWGKANNVEVVTTEEILSEDTVDLAKGFDGVTTMQFGKLADSVYPKLEEYGIKQIAQRTAGF 80
gi 21284173   22 MTKIMFFGTRDYEKEMALNWGKKNNVEVTTSKELLSSATVDQLKDYDGVTTMQFGKLEDDVYPKLESYGIKQIAQRTAGF 101
gi 49487302    1 MTKIMFFGTRDYEKEMALNWGKKNNVEVTTSKELLSSATVDQLKDYDGVTTMQFGKLEDDVYPKLESYGIKQIAQRTAGF 80
gi 57865495    1 MTKIMFFGTRAYEKDMALRWGKKNNIDVTTSTELLSVDTVDQLKDYDGVTTMQFGKLEPEVYPKLESYGIKQIAQRTAGF 80
gi 27468992    1 MTKIMFFGTRAYEKDMALRWGKKNNIDVTTSTELLSVDTVDQLKDYDGVTTMQFGKLEPEVYPKLESYGIKQIAQRTAGF 80
gi 148268957   1 MTKIMFFGTRDYEKEMALNWGKKNNVEVTTSKELLSSATVDQLKDYDGVTTMQFGKLENDVYPKLESYGIKQIAQRTAGF 80
gi 150395034   1 MTKIMFFGTRDYEKEMALNWGKKNNVEVTTSKELLSSATVDQLKDYDGVTTMQFGKLENDVYPKLESYGIKQIAQRTAGF 80
gi 156980839  22 MTKIMFFGTRDYEKEMALNWGKKNNVEVTTSKELLSSATVDQLKDYDGVTTMQFGKLENDVYPKLESYGIKQIAQRTAGF 101
gi 269204156   1 MTKIMFFGTRDYEKEMALNWGKKNNVEVTTSKELLSSATVDQLKDYDGVTTMQFGKLENDVYPKLESYGIKQIAQRTAGF 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49484727   81 DMYDLDLAKKHNIVISNVPSYSPETIAEYSVSIALQLVRRFPDIERRVQAHDFTWQAEIMSKPVKNMTVAIIGTGRIGAA 160
gi 70725546   81 DMYDLELAKKHGIIISNVPSYSPETIAEYSVSIALQLVRRFPAIEKRVQEHNFKWAAPIMSTPVKNMTVAIIGTGRIGAA 160
gi 21284173  102 DMYDLDLAKKHNIVISNVPSYSPETIAEYSVSIALQLVRRFPDIERRVQAHDFTWQAEIMSKPVKNMTVAIIGTGRIGAA 181
gi 49487302   81 DMYDLDLAKKHNIVISNVPSYSPETIAEYSVSIALQLVRRFPDIERRVQAHDFTWQAEIMSKPVKNMTVAIIGTGRIGAA 160
gi 57865495   81 DMYDLELAKKHEIIISNIPSYSPETIAEYSVSIALQLVRKFPTIEKRVQAHNFTWASPIMSRPVKNMTVAIIGTGRIGAA 160
gi 27468992   81 DMYDLELAKKHEIIISNIPSYSPETIAEYSVSIALQLVRKFPTIEKRVQAHNFTWASPIMSRPVKNMTVAIIGTGRIGAA 160
gi 148268957  81 DMYDLDLAKKHNIVISNVPSYSPETIAEYSVSIALQLVRRFPDIERRVQTHDFTWQAEIMSKPVKNMTVAIIGTGRIGAA 160
gi 150395034  81 DMYDLDLAKKHNIVISNVPSYSPETIAEYSVSIALQLVRRFPDIERRVQTHDFTWQAEIMSKPVKNMTVAIIGTGRIGAA 160
gi 156980839 102 DMYDLDLAKKHNIVISNVPSYSPETIAEYSVSIALQLVRRFPDIERRVQTHDFTWQAEIMSKPVKNMTVAIIGTGRIGAA 181
gi 269204156  81 DMYDLDLAKKHNIVISNVPSYSPETIAEYSVSIALQLVRRFPDIERRVQTHDFTWQAEIMSKPVKNMTVAIIGTGRIGAA 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49484727  161 TAKIYAGFGATITAYDAYPNKDLDFLTYKDSVKEAIKDADIISLHVPANKESYHLFDKTMFDHVKKGAILVNAARGAVIN 240
gi 70725546  161 TGKIYAGFGAKVVGYDAYPNNSLDFLEYKDTVEEAIADADIISLHVPANKESFHLFDADMFSKVKKGAVLVNAARGAVID 240
gi 21284173  182 TAKIYAGFGATITAYDAYPNKDLDFLTYKDSVKEAIKDADIISLHVPANKESYHLFDKAMFDHVKKGAILVNAARGAVIN 261
gi 49487302  161 TAKIYAGFGATITAYDAYPNKDLDFLTYKDSVKEAIKDADIISLHVPANKESYHLFDKAMFDHVKKGAILVNAARGAVIN 240
gi 57865495  161 TGKIYAGFGARVVGYDAYPNHSLSFLEYKETVEDAIKDADIISLHVPANKDSFHLFDNNMFKNVKKGAVLVNAARGAVIN 240
gi 27468992  161 TGKIYAGFGARVVGYDAYPNHSLSFLEYKETVEDAIKDADIISLHVPANKDSFHLFDNNMFKNVKKGAVLVNAARGAVIN 240
gi 148268957 161 TAKIYAGFGATITAYDAYPNKDLDFLTYKDSVKEAIKDADIISLHVPANKESYHLFDKAMFDHVKKGAILVNAARGAVIN 240
gi 150395034 161 TAKIYAGFGATITAYDAYPNKDLDFLTYKDSVKEAIKDADIISLHVPANKESYHLFDKAMFDHVKKGAILVNAARGAVIN 240
gi 156980839 182 TAKIYAGFGATITAYDAYPNKDLDFLTYKDSVKEAIKDADIISLHVPANKESYHLFDKAMFDHVKKGAILVNAARGAVIN 261
gi 269204156 161 TAKIYAGFGATITAYDAYPNKDLDFLTYKDSVKEAIKDADIISLHVPANKESYHLFDKAMFDHVKKGAILVNAARGAVIN 240
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49484727  241 TPDLIDAVNDGTLLGAAIDTYENEAAYFTNDWTNKDIDDKTLLELIEHERILVTPHIAFFSDEAVQNLVEGGLNAALSVI 320
gi 70725546  241 TPELIKAINDGTLYGAAIDTYENEAPYFTYDWTGKEIEDETLLELIKHENILVTPHIAFFSDEAVRNLVEGGLNAALSVI 320
gi 21284173  262 TPDLIAAVNDGTLLGAAIDTYENEAAYFTNDWTNKDIDDKTLLELIEHERILVTPHIAFFSDEAVQNLVEGGLNAALSVI 341
gi 49487302  241 TPDLIAAVNDGTLLGAAIDTYENEAAYFTNDWTNKDIDDKTLLELIEHERILVTPHIAFFSDEAVQNLVEGGLNAALSVI 320
gi 57865495  241 TPDLIEAVNNGTLSGAAIDTYENEANYFTFDCSNQTIDDPILLDLIRNENILVTPHIAFFSDEAVQNLVEGGLNAALSVI 320
gi 27468992  241 TPDLIEAVNNGTLSGAAIDTYENEANYFTFDCSNQTIDDPILLDLIRNENILVTPHIAFFSDEAVQNLVEGGLNAALSVI 320
gi 148268957 241 TPDLIAAVNDGTLLGAAIDTYENEAAYFTNDWTNKDIDDKTLLELIEHERILVTPHIAFFSDEAVQNLVEGGLNAALSVI 320
gi 150395034 241 TPDLIAAVNDGTLLGAAIDTYENEAAYFTNDWTNKDIDDKTLLELIEHERILVTPHIAFFSDEAVQNLVEGGLNAALSVI 320
gi 156980839 262 TPDLIAAVNDGTLLGAAIDTYENEAAYFTNDWTNKDIDDKTLLELIEHERILVTPHIAFFSDEAVQNLVEGGLNAALSVI 341
gi 269204156 241 TPDLIAAVNDGTLLGAAIDTYENEAAYFTNDWTNKDIDDKTLLELIEHERILVTPHIAFFSDEAVQNLVEGGLNAALSVI 320
                        330
                 ....*....|
gi 49484727  321 NTGTCETRLN 330
gi 70725546  321 NTGKCETQLN 330
gi 21284173  342 NTSTCETRLN 351
gi 49487302  321 NTSTCETRLN 330
gi 57865495  321 NTGTCDTRLN 330
gi 27468992  321 NTGTCDTRLN 330
gi 148268957 321 NTGTCETRLN 330
gi 150395034 321 NTGTCETRLN 330
gi 156980839 342 NTGTCETRLN 351
gi 269204156 321 NTGTCETRLN 330
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap