Conserved Protein Domain Family
PRK12469

?
PRK12469: PRK12469 
RNA polymerase factor sigma-54; Provisional
Statistics
?
PSSM-Id: 237109
View PSSM: PRK12469
Aligned: 25 rows
Threshold Bit Score: 498.961
Threshold Setting Gi: 34557733
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17549890    2 VKAALEMRAKQHLALTPRLQQSVKLLQLSATEFAQEMQEALASNPFLEEVDDNTGAPPEAARPGEA--MPGTEADGATAD 79
gi 91778926    1 -MPSIELRTRQSLALTPRLQQSVRLLQLSSLEFQQELRTALDTNPFLEYDSTDTEDVALATTASGE--EAGALPAADTVS 77
gi 27376994    3 LTQRLEFRQSQSLVMSPQLMQAIKLLQLSNLDLMTFVEEELECNPLLERASDDAAGAEAPTEVDQV--SGDQLAEAQVRD 80
gi 187920132   1 -MPSIELRTRQSLALTPRLQQSVRLLQLSSLEFQQELRTALDTNPFLEYDSSETEDVALATATSGE--DGGALPATDTVA 77
gi 187925968   2 VKAALEMRAKQHLALTPRLQQSVKLLQLSATEFAQEMQEALASNPFLEEVEQEAGAQPDATRANDL--PGPADLDGSGTD 79
gi 186474086   1 MPPTIELRAKQTFALTPRLQQSVRLLQLSSLEFQQELRNALDTNPFLEYDPSVPEDLSAGKTADGTgaDGESLPAAERDN 80
gi 189348621   1 MSVTLALQMRQHLALTPRLQQSLRLLQLSSLEFQQELRQALDTNPFLEDGQGDDEVAAPDPAAEAA--APEAAP------ 72
gi 241665452   2 VKAALEMRAKQHLALTPRLQQSVKLLQLSATEFAQEMQEALASNPFLEEVEQEAGAQPDATRANDL--PGPADLDGSGTD 79
gi 295699641   1 -MPSIELRTRQSLALTPRLQQSVRLLQLSALEFQQELRTALDTNPFLEYDSSEAEDVALAGTTPTD----GEDANAPAVD 75
gi 300694728   2 VKAALEMRAKQHLALTPRLQQSVKLLQLSATEFAQEMQEALTSNPFLEEVEDNTGTPPEAARAGEA--MPGSEADSAAAD 79
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17549890   80 HSPPDEApletttsaiETDPaiaaSdE---FPADFGSYTSYGPAHHGDGEDSDIGEWVHATPTLREHLRQELLSYRLSER 156
gi 91778926   78 AAEPDAMssdmqsesgGNDTlessGqDdmpGDFSGDYSSRSSTRQNGDSDGSDPAEWARSQPTLREQLHDSLRLYRLDDR 157
gi 27376994   81 AR------------------------------DGAMTTYTEWGGGGSGDEDYNLEAFVASETTLSDHLAEQLSVAFTAPA 130
gi 187920132  78 SAEPDSLpve----sgNNDTlesaGhDdmpGDFSGDYSSRSSTRQNGDSDSSDPAEWARSQPTLREQLHDSLRLYRLDDR 153
gi 187925968  80 HTPSEALpletttsaiETDPalatAdE---FPADFGTYYSHGGAHHGDGEDSDIGEWVHATPSLREHLHQELRSYRLSQR 156
gi 186474086  81 ALETSQAepaaesvaaSDDG----------GDYAGDAYGRGPSRYNGDSEAADPTEWARAQPTLHEQLHDALRLYRLDDR 150
gi 189348621  73 ----------------ERDEvrpvDgE---LSYTAAPAPRGGSRQGEDGGDLSPGEWMAAEPSLHQHLHEALRLYPLNRR 133
gi 241665452  80 HTPSEALpletttsaiETDPalatAdE---FPADFGTYYSHGGAHHGDGEDSDIGEWVHATPSLREHLHQELRSYRLSQR 156
gi 295699641  76 TLAAAEPdglp-aensGSDTlesaGqDdmpADFSGDYGSRSSARQNGDGDGSDPADWARSQPTLREQLHDALRLYRLDDR 154
gi 300694728  80 RTPPDDApletttsaiETDPaidaSdE---FPADFGSYTSYGSAHHGDGEDNDIGEWVHATPSLREHLHQELRSYRLSER 156
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17549890  157 DSLLALTVVEALDDDGYLRQTLFELMPLAPVESAPTEKEMQIALALVQSLDPPGVAARDLSECLRLQIEARPADTEAeer 236
gi 91778926  158 DRAVARFIIEALDDDGYLRQDLADLADSVDLEPELTEDELLVALRLVQSLDRPGLGARTLSECLSLQVNALPADTPG--- 234
gi 27376994  131 QRMIGQYLIDLVDEAGYLPPDLGQ----AAERLGATQEDVEHVLAVLQEFDPPGVCARNLRECLAIQLRELDRYDPA--- 203
gi 187920132 154 DRAVARFIIEALDDDGYLRQELSDLADSVDLEPELTEEELLVALRLVQSLDRPGLGARSLSECLLLQVNALPADTPG--- 230
gi 187925968 157 DCLLGQTVIEALDDDGYLRQLLSELIPLAPVEPPPTEKEMQIALALVQSLDPPGVAARDLSECLRLQIEARPADTEAeer 236
gi 186474086 151 DREVARLVIEALDDDGYLRQDLADLTDIVDIEPELTEDELLVALRLVQTLDRPGLAARSLSECLSLQLDALPADTPG--- 227
gi 189348621 134 DREAARLVIDALDDDGYLRQEPGDLLGAADPALLLSERDLSVALRLVQMLDRPGIAARSLSECLLLQLDAIPAGTPA--- 210
gi 241665452 157 DCLLGQTVIEALDDDGYLRQLLSELIPLAPVEPPPTEKEMQIALALVQSLDPPGVAARDLSECLRLQIEARPADTEAeer 236
gi 295699641 155 DRAVARFIIEALDEDGYMRQSLADLADSVDLEPTLTEEELLVALRLVQSLDRPGLGARSLSECLALQINALPADTPG--- 231
gi 300694728 157 DSLLAQTVIEALDDDGYLRQTLSELMPLAPVEPAPAEKEMQIALALVQSLDPPGVAARDLAECLRLQIEARPADTEAeer 236
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17549890  237 vQEIAQDIVRSHLPRLAKRDLTHIRRAVGCDEDELREACALIRTLDPRPGLRFSQAHAGYVVPDVIVAKIKG-KWVAVTN 315
gi 91778926  235 -REVARQIVEHHLERLARREQAELQKQIGCSAEELRVACALVRKLDPKPGNCYGRTEDNYVVPDVIVRQVRN-KWVVAIN 312
gi 27376994  204 -----MQALVEHLDLLAKRDIASLRKLCGVDDEDIADMIDELRRLSPKPGMKFGSARLQTMVPDVYVRPAPDgGWHVELN 278
gi 187920132 231 -RDVARQVVEHHLERLARREQAELQKQIGCSAEELRVACALVRKLDPKPGNSYGRTEDNYVVPDVIVRQVRN-KWVVTIN 308
gi 187925968 237 iQEVAHDIVRSHLPRLAKREFTQMRRALGCTEDELRDACALIRMLDPRPGLRFSQAHAGYIVPDVIVAKIRG-KWIAVTN 315
gi 186474086 228 -RNVAKQVVEHHLDRLARREHAELQKQIGCDAEELRVACALVRKLDPKPGNSYGRADDNYIVPDVIVRSVRN-KWVVTVN 305
gi 189348621 211 -LPEAKAIAREHLERLARRETAEIQRRIGCNQQTLQAACALVRGLDPRPGNHYGSTRGDYVVPDVIVRQVRD-EWVVTIN 288
gi 241665452 237 iQEVAHDIVRSHLPRLAKREFTQMRRALGCTEDELRDACALIRMLDPRPGLRFSQAHAGYIVPDVIVAKIRG-KWIAVTN 315
gi 295699641 232 -RDVARQIAEHHLERLARREQAELQKQIGCSAEELRVACALVRKLDPKPGNCYGRAEDNYVVPDVIVRQARN-KWVVSIN 309
gi 300694728 237 vQEIALDIVRSHLPRLAKRDLTHIRRAVGCEEDELREACALIRTLDPRPGLRFSQAHAGYIVPDVIVAKIKG-KWVAVTN 315
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17549890  316 PAVAPCARINKVYAELFAQTRGH--HRTPLAHQLQEARWLIRNAQQRFATIQRVAEAIVAHQKHFLEYGEVAMRPLVLRD 393
gi 91778926  313 PAVQPRARIHRMYAELFAQSAGA--SRSPLAQQLQEARWLIRNAQQRFDTIQRVAECIVAHQKAFFQYGEIALKPMVLRD 390
gi 27376994  279 SDTLPRVLVNQTYYSKLSKKIGKdvDKSYFNDALQNATWLVRALDQRARTILKVATEIVRQQDGFFTLGVAHLRPLNLKA 358
gi 187920132 309 PAVQPRARIHRMYAELFAQSAGA--SRSPLAQQLQEARWLIRNAQQRFDTIQRVAECIVAHQKAFFQYGEIALKPMVLRD 386
gi 187925968 316 PAVAPCARINKVYAELFAQTRGY--HRTPLAHQLQEARWLIRNAQQRFATIQRVAEAIVAHQKHFLEYGEVAMKPLVLRD 393
gi 186474086 306 PAVLPRARIHRMYAELFAQSAGA--SRSPLAQQLQEARWLIRNAQQRFETIQRVAECIVAHQKPFFQYGEIALKPLVLRD 383
gi 189348621 289 PAVLPRARLHERYATLFAQSSGE--RDSPLGQQLQEARWLIRNVQKRFDTIQRVGECIVARQRDFFRYGEIAMKPLVLRD 366
gi 241665452 316 PAVAPCARINKVYAELFAQTRGY--HRTPLAHQLQEARWLIRNAQQRFATIQRVAEAIVAHQKHFLEYGEVAMKPLVLRD 393
gi 295699641 310 PAVQPRARIHRMYAQLFAQSAGA--SRSPLAQQLQEARWLIRNAQQRFDTIQRVAECIVAHQKAFFQYGEIALKPMVLRD 387
gi 300694728 316 PAVAPCARINKVYAELFAQTRGH--HRTPLAHQLQEARWLIRNAQQRFATIQRVAEAIVAHQKHFLEYGEVAMRPLVLRD 393
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17549890  394 VAEELGLHESTISRATGNKFMATPRGIFEFKYFFSRQLATDTGGAC-SAASVRALLKEMIEAEDAQAPLSDVSLAKMLAE 472
gi 91778926  391 VADELGLHESTISRATGNKYMATPRGIFEFKHFFPRELGTESGGTC-SAAAVRALLKEMIAAENTRDPLSDVTLAKMLAD 469
gi 27376994  359 VAEAIQMHESTVSRVTANKYMATNRGTFELKYFFTASIPSADGGEAhSAEAVRHRIKQLIESEEPSAVLSDDAIVERLRV 438
gi 187920132 387 VADELGLHESTISRATGNKYMATPRGIFEFKHFFPRELGTESGGTC-SAAAVRALLKEMIAAENTHDPLSDVTLAKMLAD 465
gi 187925968 394 VAEELGLHESTISRATGNKYMATPRGIFEFKYFFSRQLATDTGGAC-SAASVRALLKEMIEAEDADAPLSDVSLAKMLAE 472
gi 186474086 384 VAEELGLHESTISRATGNKYMATPRGIFEFKHFFPRELGTESGGTC-SAAAVRALLKEMIAAENTRDPLSDVALAKMLAD 462
gi 189348621 367 IAEELDLHESTVSRATGNKYMATPHGTFEFKHFFPRKLEAAGRGVC-SASAAKVLIRDMIAAERHTDPLSDVALTQNLAG 445
gi 241665452 394 VAEELGLHESTISRATGNKYMATPRGIFEFKYFFSRQLATDTGGAC-SAASVRALLKEMIEAEDADAPLSDVSLAKMLAE 472
gi 295699641 388 VADELGLHESTISRATGNKYMATPRGIFEFKHFFPRELGTESGGTC-SAAAVRALLKEMIAAENARDPLSDVTLAKMLAD 466
gi 300694728 394 VAEELGLHESTISRATGNKFMATPRGIFEFKYFFSRQLATDTGGAC-SAASVRALLKEMIEAEDAQAPLSDVSLAKMLAE 472
                        490       500
                 ....*....|....*....|....*...
gi 17549890  473 QGVIVARRTVAKYRGLMRIAPAELRRQI 500
gi 91778926  470 QGVLVARRTVAKYRHLMKVPPAELRRQV 497
gi 27376994  439 SGIDIARRTVAKYREAMRIRSSVQRRRD 466
gi 187920132 466 QGVLVARRTVAKYRHLMKVPPAELRRQI 493
gi 187925968 473 QGVIVARRTVAKYRGLMRIAPAEMRRQV 500
gi 186474086 463 QGVLVARRTVAKYRHLMKVPPAELRRQV 490
gi 189348621 446 RGILLARRTVTKYRQAMKIPPAELRRRD 473
gi 241665452 473 QGVIVARRTVAKYRGLMRIAPAEMRRQV 500
gi 295699641 467 QGVLVARRTVAKYRHLMKVPPAELRRQL 494
gi 300694728 473 QGVIVARRTVAKYRGLMRIASAELRRQV 500
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap