Conserved Protein Domain Family
PRK12446

?
PRK12446: PRK12446 
undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase; Reviewed
Statistics
?
PSSM-Id: 171505
View PSSM: PRK12446
Aligned: 26 rows
Threshold Bit Score: 629.196
Threshold Setting Gi: 218899419
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 52141246    1 MKKIVFTGGGSAGHVTPNLAIIPYLKEDNWDISYIGSHQGIEKTIIEKEDILYYSIASGKLRRYFDLKNIKDPFLVMKGV 80
gi 30021842    2 SKTILFTGGGTAGHVMINIVLIPKFIEKGWRVEYIGSKNGIEKSLV--QNVKYNSVSTGKLRRYWDWDNFKDPFKIIRGC 79
gi 118478972   2 NKKILFTGGGTAGHVMINMVLIPKFMGKGWGVEYIGSQNGIEKLLV--QNVKYNSISTGKLRRYWDWENFKDPFKIIKGC 79
gi 163942013   1 MKKIVFTGGGSAGHVTPNLAIIPHLQKQNWDISYIGSHQGIEKTIIEKEGIPYHSIASGKLRRYFDLKNIKDPFLVMKGV 80
gi 218231507   2 SKTILFTGGGTAGHVMINIVLIPKFIEKGWRVEYIGSKNGIEKSLV--QNVKYNSVSTGKLRRYWDWENFKDPFKIIRGC 79
gi 218898850   2 SKTILFTGGGTAGHVMINIVLIPKFIEQGWRVEYIGSKNGIEKSLV--KNVKYNSVSTGKLRRYWDWENFKDPFKIISGC 79
gi 218899419   1 MKKIVFTGGGSAGHVTPNLAIIPHLQEDNWDISYIGSHQGIEKTIIEKEGIPYYSISSGKLRRYFDLKNIKDPFLVMKGV 80
gi 225865729   2 NKKILFTGGGTAGHVMINMVLIPKFMGKGWGVEYIGSQNGIEKLLV--QNVKYNSISTGKLRRYWDWENFKDPFKIIKGC 79
gi 296504251   2 SKTILFTGGGTAGHVMINIVLIPKFIEKGWRVEYIGSKNGIEKSLV--QNVKYNSVSTGKLRRYWDWENFKDPFKIIRGC 79
gi 296504750   1 MKKIVFTGGGSAGHVTPNLAIIPYLQEDNWDISYIGSHQGIEKTIIEKEGIPYYSISSGKLRRYFDLKNIKDPFLVMKGV 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 52141246   81 MDAYVRIRKLKPDVIFSKGGFVSVPVVIGGWLNRVPVLLHESDMTPGLANKIALRFASKIFVTFEEAAKHLPKEKVIYTG 160
gi 30021842   80 LQSYNLIKKTKPDVIFSAGGFVSVPVAIGAWLNRVPIIIREPDSTLGLANKIALPFATKLCTTFPQTGENVSNEKKVYVG 159
gi 118478972  80 IQSYKLMKRIKPDVIFSAGGFVSVPVVIGAWMNKVPVIIREPDSTLGLANKIALPFTTKLCTTFPQTGENVSNEKKVYVG 159
gi 163942013  81 MDAYVTIRKLKPDVIFSKGGFVSVPVVIGGWLNRVPVLLHESDMTPGLANKIALRFASKIFVTFEEAAKHLPKEKVIYTG 160
gi 218231507  80 LQSYNLIKKTKPDVIFSAGGFVSVPVAIGAWLNRVPIIIREPDSTLGLANKIALPFATKLCTTFPQTGENVSNEKKVYVG 159
gi 218898850  80 LQSYKLIKKTKPDVIFSAGGFVSVPVAIGAWLNRVPIIIREPDSTLGLANKIALPFATKLCTTFPQTGENVSNEKKVYVG 159
gi 218899419  81 MDAYVRIRKLKPDVIFSKGGFVSVPVVIGGWLNRVPVLLHESDMTPGLANKIALRFASKIFVTFEEAAKHLPKGKVIYTG 160
gi 225865729  80 IQSYKLMKRIKPDVIFSAGGFVSVPVVIGAWMNKVPVIIREPDSTLGLANKIALPFTTKLCTTFPQTGENVSNEKKVYVG 159
gi 296504251  80 LQSYNLIKKTKPDVIFSAGGFVSVPVAIGAWLNRVPIIIREPDSTLGLANKIALPFATKLCTTFPQTGENVSNEKKVYVG 159
gi 296504750  81 MDAYVRIRKLKPDVIFSKGGFVSVPVVIGGWLNRVPVLLHESDMTPGLANKIALRFASKIFVTFEEAAKHLPKEKVIYTG 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 52141246  161 SPVREEVLKGNREKALAFLGFSRKKPVITIMGGSLGAKKINETVREALPELLRKYQIVHLCGRGNLDDSLQNKEGYRQFE 240
gi 30021842  160 PIVRVEIEKGNVLRGRRYCEFQQDKPVLLIMGGSQGAKWINDMVRECLDTILLNFNIIHICGKGKVDPSI-GMEGYMQFE 238
gi 118478972 160 PIVREEIERGNVLRGRSYCKFQQDKPVLLIMGGSQGAQWINDMVRGSLETLLLNFNIVHMCGKGKVDSSI-GMEGYIQFE 238
gi 163942013 161 SPVREDVLRGNLEKGLKFLGFSRKKSVITVMGGSLGAKKINETVRSALPDLLKNYQIVHLCGKGNLDESLQNKEGYRQFE 240
gi 218231507 160 PIVREEIEKGNVLRGRRYCEFQQDKPVLLIMGGSQGAKWINDMVRECVDTILLNFNIIHICGKGKVDPSI-GMEGYMQFE 238
gi 218898850 160 PIVREEIEKGNVLRGRRYCEFQQDKPVLLIMGGSQGAKWINDMVRKCLDTILLNFNIIHICGKGKVDPSI-GMEGYMQFE 238
gi 218899419 161 SPVREEVLKGNSETGLAFLGFSRKKPVITIMGGSLGAKKINDTAREALPELLKKYQIVHLCGKGNLDESLQNKEGYRQFE 240
gi 225865729 160 PIVREEIERGNVLRGRSYCKFQQDKPVLLIMGGSQGAQWINDMVRGSLETLLLNFNIVHMCGKGKVDSSI-GMEGYIQFE 238
gi 296504251 160 PIVREEIEKGNVLRGRRYCEFQQDKPVLLIMGGSQGAKWINDMVRECLDTILLNFNIIHICGKGKIDPSI-GMEGYMQFE 238
gi 296504750 161 SPVREEVLKGNREKGLAFLGFSRKKPVITIMGGSLGAKKINDTAREALPELLKKYQIVHLCGKGNLDESLQNKEGYRQFE 240
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 52141246  241 YVHGELPDILAITDFVISRAGSNAIFEFLTLQKPMLLIPLSKFASRGDQILNAESFERQGYASVLYEEDVTVNSLIKHVE 320
gi 30021842  239 YIGDELPHILNMASVVVSRAGSTAISELLFLKKPMLLIPLTNSSSRGDQVLNAEYFSRQGYAEVILQDRVSTNTFIHAVN 318
gi 118478972 239 YIGEELPHILNMASVVVSRAGSTAIFELLFLKKPMLLIPLTNSSSRGDQVLNAEYFSRQGYAEVILQDRVSTNTFIHAVN 318
gi 163942013 241 YVHEELPDILAATDFVISRAGSNAIFEFLTMQKPMVLIPLSKFASRGDQILNAESFKRQGYASVLYEEDVTVNSLIKHIE 320
gi 218231507 239 YIGDELPHILNMASVVVSRAGSTAISELLFLKKPMLLIPLTNSSSRGDQVLNAEYFSRQGYAEVILQDRVSTNTFIHAVN 318
gi 218898850 239 YIGDELPHILNMASVVVSRAGSTAISELLFLKKPMLLIPLTNSSSRGDQGLNAEYFSRQGYAEVILQDRVNTNTFIHAVN 318
gi 218899419 241 YVHGELPDILAVTDFVISRAGSNAIFEFLTLQKPMVLIPLSKFASRGDQILNAESFERQGYASVLYEEDVTVKSLIKYVE 320
gi 225865729 239 YIGEELPHILNMASVVVSRAGSTAIFELLFLKKPMLLIPLTNSSSRGDQVLNAEYFSRQGYAEVILQDRVSTNTFIHAVN 318
gi 296504251 239 YIGDELPHILNMASVVVSRAGSTAISELLFLKKPMLLIPLTNSSSRGDQVLNAEYFSRQGYAEVILQDRVSTNTFIHAVN 318
gi 296504750 241 YVHGELPDILAVTDFVISRAGSNAIFEFLTLQKPMVLIPLSKFASRGDQILNAESFERQGYASVLYEEDVNVKSLIKYVE 320
                        330       340       350
                 ....*....|....*....|....*....|....
gi 52141246  321 ELSHNNEAYKTALKKYN--GKEAIQTIIHHISEA 352
gi 30021842  319 KLYTNKEKYIQNMNGYKktNDEGIHQIIDIINEV 352
gi 118478972 319 KLNTNKERYIQNMNGYTktNDEGIHQLIDIINEV 352
gi 163942013 321 ELSHNNETYKTALKKYN--GKEAIKTIIQHISEA 352
gi 218231507 319 KLYTNKEKYIQNMNGYKktNDEGIHQIIDIINEV 352
gi 218898850 319 KLYTNQEKYIQNMNEYKktNDEGIHQLVDIINDV 352
gi 218899419 321 ELNQNNEKYKTALKKYN--GKEAIQTIIQNISEA 352
gi 225865729 319 KLNTNKERYIQNMNGYTktNDEGIHQLIDIINEV 352
gi 296504251 319 KLYTNKEKYIQNMNGYKktNDEGIHQIIDIINEV 352
gi 296504750 321 ELNQNNEKYKIALKKYN--GKEAIKTIIQNISEA 352
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap