Conserved Protein Domain Family
PRK12427

?
PRK12427: PRK12427 
flagellar biosynthesis sigma factor; Provisional
Statistics
?
PSSM-Id: 183523
View PSSM: PRK12427
Aligned: 15 rows
Threshold Bit Score: 376.894
Threshold Setting Gi: 108809036
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 51597620    1 MENREFEACLTLTAAEEGKYLNAYLPLVKRIVRQLSFQADSVIGKEDMQQIALMGLLEALRRYGHPDGQFAAYAVHRIRG 80
gi 45442811    1 MENREFEACLTLTAEEEGKYLNAYLPLVKRIVRQLSFQADSVIGKEDMQQIALMGLLEALRRYGHPDGQFAAYAVHRIRG 80
gi 162420360   1 MENREFEACLTLTAEEEGKYLNAYLPLVKRIVRQLSFQADSVIGKEDMQQIALMGLLEALRRYGHPDGQFAAYAVHRIRG 80
gi 157147079   1 --MMDFIASETLTPADEARYVSTYLPLVNKVVKQLAYQTSSVIDRDDMEQIALMGLLTSLRRYGHPDEQFAAYAIQRVRG 78
gi 170682912   7 FESEEFAAAPVLTPQQESHYLQAYLPLVRKVVRQLAPQCNCIIDRQDMEQTALMGLLNAIRRYGLPDEGFAGYAVHRIRG 86
gi 170021344   6 FESEEFAAAPVLTPQQESHYLQAYLPLVRKVVRQLAPQCNCIIDRQDMEQTALMGLLNAIRRYGLPDEGFAGYAVHRIRG 85
gi 218703543   6 FESEEFAAAPVLTPQQESHYLQAYLPLVRKVVRQLAPQCNCIIDRQDMEQTALMGLLNAIRRYGLPDEGFAGYAVHRIRG 85
gi 218927931   1 MENREFEACLTLTAEEEGKYLNAYLPLVKRIVRQLSFQADSVIGKEDMQQIALMGLLEALRRYGHPDGQFAAYAVHRIRG 80
gi 260866428   1 --------------------MQAYLPLVRKVVRQLAPQCNCIIDRQDMEQTALMGLLNAIRRYGLPDEGFAGYAVHRIRG 60
gi 260853482   6 FESEEFAAAPVLTPQQESHYLQAYLPLVRKVVRQLAPQCNCIIDRQDMEQTALMGLLNAIRRYGLPDEGFAGYAVHRIRG 85
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 51597620   81 SILDQLREHDWRPRRLRQKTHKTNEAIRQIAKRLGHEPNFEEISAELNLTADEYQEYLLLENAGAMESLDEILALDAHND 160
gi 45442811   81 SILDQLREHDWRPRRLRQKTHKTNEAIRQIAKRLGHEPNFEEISAELNLTADEYQEYLLLENAGAMESLDEILALEAHND 160
gi 162420360  81 SILDQLREHDWRPRRLRQKTHKTNEAIRQIAKRLGHEPNFEEISAELNLTADEYQEYLLLENAGAMESLDEILALEAHND 160
gi 157147079  79 AVLDELRLLDWRPRRLRQKTHKLNDAIREIARQLGRTPSFEDISHHLSITAEEYQEYLLLDCAKTLESLDDLLGNDVYAG 158
gi 170682912  87 AILDELRALDWRPRQLRQKYHQMKDLIRETRKKLGHEPEWSELAVE-GISHEDYLEYQQLEGAETLASLDELLNGEGPGI 165
gi 170021344  86 AILDELRALDWRPRQLRQKYHQMKDLIRETRKKLGHEPEWSELAVE-GISHEDYLEYQQLEGAETLASLDELLNSEGPGI 164
gi 218703543  86 AILDELRALDWRPRQLRQKYHQMKDLIRETRKKLGHEPEWSELAVE-GISHEDYLEYQQLEGAETLASLDELLNGEGPGI 164
gi 218927931  81 SILDQLREHDWRPRRLRQKTHKTNEAIRQIAKRLGHEPNFEEISAELNLTADEYQEYLLLENAGAMESLDEILALEAHND 160
gi 260866428  61 AILDELRALDWRPRQLRQKYHQMKDLIRETRKKLGHEPEWSELAVE-GISHEDYLEYQQLEGAETLASLDELLNGEGPGI 139
gi 260853482  86 AILDELRALDWRPRQLRQKYHQMKDLIRETRKKLGHEPEWSELAVE-GISHEDYLEYQQLEGAETLASLDELLNGEGPGI 164
                        170       180       190       200       210       220       230
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 51597620  161 ILQSRDLEENIIIEDNLKQAISALDEREQMILHLYYQQELSMKEIAQVLDLTEARICQLNKKLVQKIKSFF 231
gi 45442811  161 ILQSRDLEENIIIEDNLKQAISTLDEREQMILHLYYQQELSMKEIAQVLDLTEARICQLNKKLVQKIKSFF 231
gi 162420360 161 ILQSRDLEENIIIEDNLKQAISTLDEREQMILHLYYQQELSMKEIAQVLDLTEARICQLNKKLVQKIKSFF 231
gi 157147079 159 ALDSRPLEEEIIVSRTLRNALASLDEREQLILTLYYQHEMSLKEIALVLNLTEARVCQLNKIIAQKIQSFF 229
gi 170682912 166 PLAGRELEDQFVTQQMLQHALSQLSEKEQLILSMYYQHEMNLKEIALVLGLTEARICQLNKQIAQKIRDFV 236
gi 170021344 165 PLAGRELEDQFVTQQMLQQALSQLSEKEQLILSMYYQHEMNLKEIALVLGLTEARICQLNKQIAQKIRDFV 235
gi 218703543 165 PLAGRELEDQFVTQQMLQYALSQLSEKEQLILSMYYQHEMNLKEIALVLGLTEARICQLNKQIAQKIRDFV 235
gi 218927931 161 ILQSRDLEENIIIEDNLKQAISTLDEREQMILHLYYQQELSMKEIAQVLDLTEARICQLNKKLVQKIKSFF 231
gi 260866428 140 PLVGRELEDQFVTQQMLQQALSQLSEKEQLILSMYYQHEMNLKEIALVLGLTEARICQLNKQIAQKIRDFV 210
gi 260853482 165 PLVGRELEDQFVTQQMLQQALSQLSEKEQLILSMYYQHEMNLKEIALVLGLTEARICQLNKQIAQKIRDFV 235
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap