Conserved Protein Domain Family
PRK12420

?
PRK12420: PRK12420 
histidyl-tRNA synthetase; Provisional
Statistics
?
PSSM-Id: 237097
View PSSM: PRK12420
Aligned: 25 rows
Threshold Bit Score: 691.857
Threshold Setting Gi: 297583175
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297583175   7 KQEDLNVKGTVTYMPEKERVRRRIRRTLEDVFIRYGCEPLETPILNQASLMTDKYGGGAEIVKEMYRLTDQGERDLALRY 86
gi 56965072    3 KWDYQNVRGTQDYLPEDESVRVWLRRELEEVFQQYGCKPMETPMINYTDLLASKYGGGAEIKKEMYTLTDRGKRALALRY 82
gi 47528660    1 -MEIRNVKGTKDYLPEEQVLRSKIKRACEDTFERYGCKPLETPTLNMYELMSYKYGGGDEILKEIYTLQDQGKRDLALRY 79
gi 30263285    1 -MEIRNVKGTKDYLPEEQVLRSKIKRACEDTFERYGCKPLETPTLNMYELMSYKYGGGDEILKEIYTLQDQGKRDLALRY 79
gi 49186135    1 -MEIRNVKGTKDYLPEEQVLRSKIKRACEDTFERYGCKPLETPTLNMYELMSYKYGGGDEILKEIYTLQDQGKRDLALRY 79
gi 150389940   2 DLELKNVKGTKDFFPNEQIIRNGIIKKLQEVFELYGYQPLETPTLYYLEVLASKYAGGAEILKETYSLKDQGERELGLRY 81
gi 227813844   1 MMEIRNVKGTKDYLPEEQVLRSKIKRACEDTFERYGCKPLETPTLNMYELMSYKYGGGDEILKEIYTLQDQGKRDLALRY 80
gi 226310121   3 NEVLKTVKGTKDFMPQEQMQRNWIRRTLEAVFETYGCKPLETPMLQHYELLASKYGGGDEILKEVYRLNDQGDRELGLRY 82
gi 229604864   1 MMEIRNVKGTKDYLPEEQVLRSKIKRACEDTFERYGCKPLETPTLNMYELMSYKYGGGDEILKEIYTLQDQGKRDLALRY 80
gi 251794967   1 ---MQNVKGTYDFFGKEQAVRQKVRSVLQEVFELYDYESMESTVLHELELLTSKYAGGDEILKEMYRFTDQGARKLGLRY 77
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297583175  87 DLTMPFARVCVMNPTLRKPFKRYEIGKVFRDGPIKAGRYREFTQCDVDVLGVSSQLAEAELMIMALDAFERLGMAVTIQY 166
gi 56965072   83 DLTIPFAKVMAMNPDIRKPFKRYEIGKVFRDGPIKAGRFREFTQCDVDVAGVDSPLAEAELLEMATEVFRRIGLNMTIQY 162
gi 47528660   80 DLTIPFAKVVAMNPNIRLPFKRYEIGKVFRDGPIKQGRFREFIQCDVDIVGVESVMAEAELMSMAFELFQTLNLEVTIQY 159
gi 30263285   80 DLTIPFAKVVAMNPNIRLPFKRYEIGKVFRDGPIKQGRFREFIQCDVDIVGVESVMAEAELMSMAFELFQTLNLEVTIQY 159
gi 49186135   80 DLTIPFAKVVAMNPNIRLPFKRYEIGKVFRDGPIKQGRFREFIQCDVDIVGVESVMAEAELMSMAFELFQTLNLEVTIQY 159
gi 150389940  82 DLTIPFSKVIGMNPNLRMPFKRYEIGKVFRDGPVKLGRMREFIQCDVDVVGVKSMMAEAELMFMATEVFDKLGLDIYLSY 161
gi 227813844  81 DLTIPFAKVVAMNPNIRLPFKRYEIGKVFRDGPIKQGRFREFIQCDVDIVGVESVMAEAELMSMAFELFQTLNLEVTIQY 160
gi 226310121  83 DLTVPLTKVVGMNPEMRMPFKRYEIGKVFRDGPVKTGRLREFIQCDVDIVGTTSVLAEAELLSMAFEAFKRLGLDVYIEV 162
gi 229604864  81 DLTIPFAKVVAMNPNIRLPFKRYEIGKVFRDGPIKQGRFREFIQCDVDIVGVESVMAEAELMSMAFELFQTLNLEVTIQY 160
gi 251794967  78 DLTIPLAKVMALNPGIKLPYRRYEIGKVFRDGPVKRGRLREFLQCDVDMVGVAGPEAEAELMLIAVEVFKRLDIPVTLRW 157
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297583175 167 NNRKFLTGLLDVFGVPESLIPSAVLTLDKLEKKGAAAVLDELLVKGVTEDVTERIGAFL--------TAGDAADIERIRv 238
gi 56965072  163 NNRKLLTGMLDICGVSKDQHSAVILILDKREKIGDKQVVNELKEMGVDGKAISKIAQWL--------KQMSQSGIVDFAt 234
gi 47528660  160 NNRKLLNGILQAINIPTELTSDVILSLDKIEKIGIDGVRKDVLERGISEEMADTICNTV--------LSCLQLSIADFK- 230
gi 30263285  160 NNRKLLNGILQAINIPTELTSDVILSLDKIEKIGIDGVRKDVLERGISEEMADTICNTV--------LSCLQLSIADFK- 230
gi 49186135  160 NNRKLLNGILQAINIPTELTSDVILSLDKIEKIGIDGVRKDVLERGISEEMADTICNTV--------LSCLQLSIADFK- 230
gi 150389940 162 NNRKLLSGTLMKLKINKELASDVILSLDKVEKIGIEGVKKELLEKNLQPEVVENIIELL--------NNKEAASIDYYK- 232
gi 227813844 161 NNRKLLNGILQAINIPTELTSDVILSLDKIEKIGIDGVRKDVLERGISEEMADTICNTV--------LSCLQLSIADFK- 231
gi 226310121 163 NNRKLLSGVLQELGVPVERAGDVMLSLDKLEKIGVDGVRDDLRERNVEESLVLAITSF---------LQEGVITLDLLK- 232
gi 229604864 161 NNRKLLNGILQAINIPTELTSDVILSLDKIEKIGIDGVRKDVLERGISEEMADTICNTV--------LSCLQLSIADFK- 231
gi 251794967 158 NNRRFLSEILDAVGVPAEDSLSVMLTLDKLEKIGSDGVLKEWRDKGISGPTVDEIAELIamsgpsfsLLADRYGLKESR- 236
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297583175 239 YGNGSQQVEEGAAELQELTSFLGATGTLDQCVFNPFLARGLEIYTGTVYEVFSAEpGALSSSIASGGRYDQAVGGLSG-S 317
gi 56965072  235 DRPTTPIMAEGIAELQELEEALRYLNIDSQCTFNPFLARGLEIYTGTVYELFLTE-GAIQSSVGSGGRYDQAISGLTG-E 312
gi 47528660  231 EAFNNPLVADGVNELQQLQQYLIALGINENTIFNPFLARGLTMYTGTVYEIFLKD-GSITSSIGSGGRYDNIIGAFRG-D 308
gi 30263285  231 EAFNNPLVADGVNELQQLQQYLIALGINENTIFNPFLARGLTMYTGTVYEIFLKD-GSITSSIGSGGRYDNIIGAFRG-D 308
gi 49186135  231 EAFNNPLVADGVNELQQLQQYLIALGINENTIFNPFLARGLTMYTGTVYEIFLKD-GSITSSIGSGGRYDNIIGAFRG-D 308
gi 150389940 233 GIASNSLMQEGIQELEELNDYLDAMGIGSKVKYNPFLARGLEIYTGTVYEIFLKD-GSITSSMGAGGRYDDIIGKFIQ-N 310
gi 227813844 232 EAFNNPLVADGVNELQQLQQYLIALGINENTIFNPFLARGLTMYTGTVYEIFLKD-GSITSSIGSGGRYDNIIGAFRG-D 309
gi 226310121 233 ERFTSPLVQEGIRELREMLAYVTGAGVAGELRFSPFLARGLGIYTGIVYEIFLQD-GSMTSSIGSGGRYDQIIGRLLD-D 310
gi 229604864 232 EAFNNPLVADGVNELQQLQQYLIALGINENTIFNPFLARGLTMYTGTVYEIFLKD-GSITSSIGSGGRYDNIIGAFRG-D 309
gi 251794967 237 ----------GAAEIRALQTLIDKLSLSDICRFDPFLSRGLSFYTGTVYEIFDAG-GLYASSIGSGGRYDAIIGKLIGsE 305
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297583175 318 DEGYPSVGISFGLDVITTVLESRidEEIQe-EKVDCLIIPVGEPQAALVLAQALRA-QGTSVELDMSGKKPGKALERANR 395
gi 56965072  313 EQPMPTVGISFGIDVIYTALKME--GRINqkPLLDYYVIPLQKQKEALAVASSLRK-QGFRVDVEFKNKKLTKALDRANK 389
gi 47528660  309 DMSYPTVGISFGLDVIYTALSQK--ETIS--STADVFIIPLGTELQCLQIAQQLRStTSLKIELELAGRKLKRALNYANK 384
gi 30263285  309 DMSYPTVGISFGLDVIYTALSQK--ETIS--STADVFIIPLGTELQCLQIAQQLRStTSLKIELELAGRKLKRALNYANK 384
gi 49186135  309 DMSYPTVGISFGLDVIYTALSQK--ETIS--STADVFIIPLGTELQCLQIAQQLRStTSLKIELELAGRKLKRALNYANK 384
gi 150389940 311 EVGYPAVGISFGLDVIYTALSMKrdNELE--SNLDVYIIPLGTEAEALKMACELRG-QGIKVDIDMTERKLKKRLDYANK 387
gi 227813844 310 DMSYPTVGISFGLDVIYTALSQK--ETIS--STADVFIIPLGTELQCLQIAQQLRStTSLKIELELAGRKLKRALNYANK 385
gi 226310121 311 GREYPAVGISFGLDVILAALANR--NTEEq-RAADVLVIPLGTEASSLGLANRLRE-SGIRVELELTGRRLKKALDYANK 386
gi 229604864 310 DMSYPTVGISFGLDVIYTALSQK--ETIS--STADVFIIPLGTELQCLQIAQQLRStTSLKIELELAGRKLKRALNYANK 385
gi 251794967 306 DMAYPAVGLSFGMESIMEMIRDR--PIPA--PTPKVVVLSIGDTMGEALMAATALRsNGIQTGMEPAGRKLKKALASLES 381
                        410       420       430
                 ....*....|....*....|....*....|....*.
gi 297583175 396 EGVRDVILIGSDEVETGIYTVKRMKTGEEEAVSFSF 431
gi 56965072  390 EKIPFVILIGEEEVASGRYKLKNMETGAEQHVPFSF 425
gi 47528660  385 ENIPYVLIIGEEEICTETVMLRNMKEGSEVKVPLSS 420
gi 30263285  385 ENIPYVLIIGEEEICTETVMLRNMKEGSEVKVPLSS 420
gi 49186135  385 ENIPYVLIIGEEEICTETVMLRNMKEGSEVKVPLSS 420
gi 150389940 388 EKIPYVLILGEDEVKSQRIKMKDMKSGTEEEMKISE 423
gi 227813844 386 ENIPYVLIIGEEEICTETVMLRNMKEGSEVKVPLSS 421
gi 226310121 387 EGFAFALIYGENEVNSGQVVVRDMREGTEQPVPLEL 422
gi 229604864 386 ENIPYVLIIGEEEICTETVMLRNMKEGSEVKVPLSS 421
gi 251794967 382 RSIRYALLIGEEEVRTGQVRLKDMKAREEYAVPLDE 417
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap