Conserved Protein Domain Family
obgE

?
PRK12298: obgE 
GTPase CgtA; Reviewed
Links
?
Statistics
?
PSSM-Id: 237047
View PSSM: PRK12298
Aligned: 213 rows
Threshold Bit Score: 429.673
Threshold Setting Gi: 302338319
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
218893661   1 MKFVDEVSIHVKAGDGGNGLMSFRREKFIEKGGPNGGDGGDGGSIYLEADVNLNTLVDYRYTRRFDAQRGENGGSKDCTG 80 
161723190   4 SNFVDYVKIYCRSGKGGRGSTHMRREKYTPNGGPDGGDGGRGGHVILRGNRNYWTLLHLRYDRHAMAGHGESGSKNRSFG 83 
150004242   4 SNFVDYVKIYCRSGKGGRGSAHMRREKYVPNGGPDGGDGGRGGHVILRGNRNYWTLLHLKYDRHVFATHGGNGSKNKSFG 83 
150008511   4 SNFVDYVKIYCRSGKGGRGSSHFRREKYIPKGGPDGGDGGRGGHVYLRGNRNYWTLLHLKYERHIMATNGESGSAKRSSG 83 
212550822   4 SNFVDYAKIHIRSGKGGKGSIHFRHEKYIPWGGSDGGNGGKGGDIILRGSRNYWTLLHLKHKYHIFADHGKAGEGKLRHG 83 
294675490   3 SNFVDYVKIYCRSGKGGKGSMHLRHVKYNPNGGPDGGDGGKGGSIILRGNHNYWTLLHLKYERHIFAEHGGNGGRDKCHG 82 
302345143   3 SNFVDYVKIYCRSGKGGRGSMHLRHVKYNPNGGPDGGDGGKGGSVYLRGNHNYWTLLHLKFQRHIYAEHGGNGGRDKCHG 82 
34540573    5 SNFVDYVKIYCRSGKGGRGSTHFRREKYIPKGGPDGGDGGRGGHVFLRGNRNYWTLLHLRYDRHIMATNGQSGGAKRSTG 84 
53712413    4 SNFVDYVKIYCRSGKGGRGSTHMRREKYTPNGGPDGGDGGRGGHVILRGNRNYWTLLHLRYDRHAMAGHGESGSKNRSFG 83 
188994677   5 SNFVDYVKIYCRSGKGGRGSTHFRREKYIPKGGPDGGDGGRGGHVFLRGNRNYWTLLHLRYDRHIMATNGQSGGAKRSTG 84 
218893661  81 AKGDDLILPVPVGTTVIDANTQEIIGDLTEPGQRLMVAQGGWHGLGNTRFKSSTNRAPRQTTPGKPGEARDLKLELKVLA 160
161723190  84 KDGADKIIEVPCGTVVYNAETGEYVCDVTEHGQEVILLKGGRGGLGNWHFKTATRQAPRFAQPGEPMQEMTVILELKLLA 163
150004242  84 KDGEDKVIEVPCGTVVYNAETGEYICDITEHGQEIILLKGGRGGLGNWHFRTATRQAPRFAQPGEPMQELMVILELKLLA 163
150008511  84 KDGEDRVIEVPCGTVVYDAETGEFICDVTEDGQQVMLLKGGRGGLGNFNFKTATNQAPRYSQPGEPALERTVILQLKLLA 163
212550822  84 KDGQNKTIELPIGTAVFDGTTGKFITDIKYDKQEIVLLKGGRGGRGNNYFKSAVNQTPKHSQPGEPYEERQIVFQLKLLA 163
294675490  83 TDGKDVYIDVPCGTVVYNAETGKYVCDVTYDGQEVMLLKGGRGGLGNFQFRTATNQAPRYAQPGEPMQEMTIILELKLLA 162
302345143  83 TDGKDIYIDVPCGTVAYDAETGKYVCDVMHDGQTVLLLKGGRGGLGNFQFRTATNQAPRYAQPGEPMQEMTVILELKLLA 162
34540573   85 ANGEDRIIEVPCGTAVYDADTGEFITDITEHGQQVMLLQGGRGGHGNTFFKTATNQAPRYAQPGEPAQERMVIMQLKMLA 164
53712413   84 KDGADKIIEVPCGTVVYNAETGEYVCDVTEHGQEVILLKGGRGGLGNWHFKTATRQAPRFAQPGEPMQEMTVILELKLLA 163
188994677  85 ANGEDRIIEVPCGTAVYDADTGEFITDITEHGQQVMLLQGGRGGHGNTFFKTATNQAPRYAQPGEPAQERMVIMQLKMLA 164
218893661 161 DVGLLGLPNAGKSTFIRAVSAAKPKVADYPFTTLVPNLGVVSVGRYKSFVVADIPGLIEGAAEGAGLGIRFLKHLARTRI 240
161723190 164 DVGLVGFPNAGKSTLLSAISAAKPKIADYPFTTLEPNLGIVSYRDGQSFVMADIPGIIEGASEGKGLGLRFLRHIERNSL 243
150004242 164 DVGLVGFPNAGKSTLLSTVSAARPKIANYPFTTLEPNLGIVSYREGKSFVMADIPGIIEGASEGKGLGLRFLRHIERNSL 243
150008511 164 DVGLVGFPNAGKSTLLSVVSAAKPKIANYPFTTLEPNLGIVSYRDNRSFVMADIPGIIEGASEGKGLGLRFLRHIERNSL 243
212550822 164 DVGLVGFPNTGKSTLLSIVSAAKPKIADYAFTTLEPNLGVVNVHNSYTFVMADIPGIVEGANEGKGLGLRFLRHIERNSL 243
294675490 163 DVGLVGFPNAGKSTLVSSLSNAKPKIANYPFTTMEPSLGIVGYRDNKSFVMADIPGIIEGASEGKGLGLRFLRHIERNSL 242
302345143 163 DVGLVGFPNAGKSTLLSSLSSAKPKIANYPFTTMEPSLGIVSYRDNQSFVMADIPGIIEGASEGKGLGLRFLRHIERNSL 242
34540573  165 DVGLVGFPNAGKSTLLSVLTAAKPKIANYPFTTLEPNLGIVAYRDKRSFVMADIPGIIEGASSGKGLGLRFLRHIERNAL 244
53712413  164 DVGLVGFPNAGKSTLLSAISAAKPKIADYPFTTLEPNLGIVSYRDGQSFVMADIPGIIEGASEGKGLGLRFLRHIERNSL 243
188994677 165 DVGLVGFPNAGKSTLLSVLTAAKPKIANYPFTTLEPNLGIVAYRDKRSFVMADIPGIIEGASSGKGLGLRFLRHIERNAL 244
218893661 241 LLHLVdmaPLDESDPADAAEVIVRELGRFSPALTERERWLVLNKMDQILDpAEREARKQAVIERLGWEGPVYVISALERD 320
161723190 244 LLFMI---PADSDDIRKDYEVLLNELKTFNPEMLDKQRVLAITKSDMLDQ-ELMDEIEPTLPEG----IPHVFISSVSGL 315
150004242 244 LLFMV---PGDTDDIRKEYEILLNELATFNPEMLDKQRVLAITKSDMLDE-----ELIAMLEPTLPDNVPHIFISSVTGL 315
150008511 244 LLFMV---PAEADDIKKEYEILHNELVKYNPELLDKRRVLAITKSDMLDE-ELIEALSQDLPEG----IPYVFISSITGL 315
212550822 244 LLFMI---PSDANDIANEYKILLNELACYNSELLNKQRILAISKSDMLDT-----KLEDVIKKELPTDIPHIFISSFTQK 315
294675490 243 LLFMV---PGDTDDIKREYEILLNELQQFNPEMLDKHRVLAVTKCDLLDE-----ELVEMLKETLPQDLPVVFISAVTGY 314
302345143 243 LLFMV---PGDTDDIKREYEVLLNELQQFNPEMLDKHRVLAVTKSDLLDD-----ELIEMLRETLPTDLPVVFISAVTGQ 314
34540573  245 LLFMI---PADTDNIAKEYEILSRELVAYNEELAQKRKVLAITKCDLIDE-----ELCEMLREELPTGLPVVFISAVAQQ 316
53712413  244 LLFMI---PADSDDIRKDYEVLLNELKTFNPEMLDKQRVLAITKSDMLDQ-ELMDEIEPTLPEG----IPHVFISSVSGL 315
188994677 245 LLFMI---PADTDNIAKEYEILSRELVAYNEELAQKRKVLAITKCDLIDE-----ELCEMLREELPTGLPVVFISAVAQQ 316
218893661 321 GT------EALSQDIM-----------RYLDERTLRle---eDPQYAEELAEL--------DRRIEDE---ARARLQald 369
161723190 316 GI-------SVLKDILwtelnkesnkiEAIVHRPKDvsrlqqELKDMGEDEEL--------DYEYEDDgd---------- 370
150004242 316 GIqq---lKDILWTEL---------------------------NKDSNKLEGV--------RTETIVH---RAKDVAklq 354
150008511 316 GIve---lKDLLWKEL--------------------------NKENFHEAERI------------------VHKNIDvst 348
212550822 316 GI-------------------------TVLK------------------------------DLLWEKL---RFHDMKeis 337
294675490 315 GLde---lKDVLWNEL-----------NAESNKLNVit---sEDSLVHRDKDM--------SRFAQELa----------- 358
302345143 315 GI------DDLKDILW-----------KELNAESNKlqsilsEDTLVHRDKDM--------SRFAAEL---AAEDADidd 366
34540573  317 GLee---lKDTLWKEL--------------------------SKETLHEPDSIvrqaldltSLTWDEEddlFPASIEd-- 365
53712413  316 GI------SVLKDILW-----------TELNKESNK------IEAIVHRPKDV------------------SRLQQElkd 354
188994677 317 GLeelkdtLWKEL-----------------------------SKETLHEPDSIvrqaldltsltw--------------- 352
218893661 370 daralrr---sglknagavdDDDf----------dDE-------EDd-----GDGPEIFYVP 406
161723190 371 -------------------gDEDdldy----eyeeEDw-----eDK---------------- 388
150004242 355 eelkdmgededfeyeyeedaDDDfdy------eyeDEnw----dEEe-----EKK------- 394
150008511 349 l---------------efedDDEyifpvdededdpDEeyeeywdDDe-----DEDTRK---- 386
212550822     --------------------------------------------------------------
294675490 359 -------------------dEGEdedieyideddiEDiedfeyeDFd-----DEA------- 389
302345143 367 veev-----------gideldEV------------EDledfeytND---------------- 389
34540573  366 --------------------dEDeeglddidfdleIEy-----dNEg-----DDAPDQL--- 394
53712413  355 -------------------mgED------------EEldyeyedDGd-----EDDLDYEYEE 380
188994677 353 --------deeddlfpasieDDE------------DEeglddidFDleieydNEGDDAPDQL 394
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap