Conserved Protein Domain Family
hisZ

?
PRK12292: hisZ 
ATP phosphoribosyltransferase regulatory subunit; Provisional
Statistics
?
PSSM-Id: 237043
View PSSM: PRK12292
Aligned: 187 rows
Threshold Bit Score: 284.066
Threshold Setting Gi: 189911409
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81299624    1 MVHQPPAGTRDLLPQDVTQKRWIESRLQQVFQQWGYQRIITPTLERLDTLVAGG--AVQRSAVIQVQSdEESGLGLRPEL 78
gi 237794905   4 WNKYIPKGMKDILFEESNIKLDIEDQLRKIYKYSGFSEIISPTIEFYDVFNSNIqaIPQEKMYKLFDN-LGRILVLRPDM 82
gi 16802612    3 LNKNLPTGTRDKLFREARAAYKIEQQVNHYFEKRGFKRIETPVIEFEDVFSSEH--QADAKLYRFFDE-KGRLTVLRPDM 79
gi 46906814    3 LNKNLPTGTRDKLFREAQAAYKIEQQVNHYFEKRGFKRIETPVIEFEDVFSSEH--QADAKLYRFFDE-KGRLTVLRPDM 79
gi 217965337   3 LNKNLPTGTRDKLFREAQAAYKIEQQVNHYFEKRGFKRIETPVIEFEDVFSSEH--QADAKLYRFFDE-KGRLTVLRPDM 79
gi 226223198   3 LNKNLPTGTRDKLFREAQAAYKIEQQVNHYFEKRGFKRIETPVIEFEDVFSSEH--QADAKLYRFFDE-KGRLTVLRPDM 79
gi 284994035   3 LNKNLPTGTRDKLFREARAAYKIEQQVNHYFEKRGFKRIETPVIEFEDVFSSEH--QADAKLYRFFDE-KGRLTVLRPDM 79
gi 284800849   3 LNKNLPTGTRDKLFREARAAYKIEQQVNHYFEKRGFKRIETPVIEFEDVFSSEH--QADAKLYRFFDE-KGRLTVLRPDM 79
gi 16799653    3 LNKNLPTGTRDKLFREARASYQIEQQVNHYFAKRGFKRIETPVIEFEDVFSSEH--QADAKLYRFFDE-KGRLTVLRPDM 79
gi 116871955   3 LNKNLPTGTRDKLFREAQAAYKIEQQVNHYFEKRGFKRIETPVIEFEDVFSSEH--QADAKLYRFFDE-KGRLTVLRPDM 79
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81299624   79 TASIARAAVTRLAGSSLPLRLYYLANVFRPAfQGDRLQQRELFQAGVELLGVGGTLADAEVLHVLADALAELGfgqppLG 158
gi 237794905  83 TTPIGRITGTKMKDCTYPLKLCYTANIFRVN-EKLNGKRGEITQSGIEIIGTKGIKSDVDSIVTAINALLSLG-----LR 156
gi 16802612   80 TLPIGRVVSTT--GVMLPLKLSYSGKIFRAN-EDFGGEQNEQTQAGIEIIGYPSIKAEIECILIGIGVLNALE-----IP 151
gi 46906814   80 TLPIGRVVSTT--GVMLPLKLSYSGKIFRAN-EDFGGEQNEQTQAGIEIIGYPSIKAEIECILSGIGVLNALE-----IP 151
gi 217965337  80 TLPIGRVVSTT--GVTLPLKLSYSGKIFRAN-EDFGGEQNEQTQAGIEIIGYPSIKAEIECILSGIGVLNALE-----IP 151
gi 226223198  80 TLPIGRVVSTT--GVMLPLKLSYSGKIFRAN-EDFGGEQNEQTQAGIEIIGYPSIKAEIECILSGIGVLNALE-----IP 151
gi 284994035  80 TLPIGRVVSTT--GVMLPLKLSYSGKIFRAN-EDFGGEQNEQTQAGIEIIGYPSIKAEIECILIGIGVLNALE-----IP 151
gi 284800849  80 TLPIGRVVSTT--GVMLPLKLSYSGKIFRAN-EDFGGEQNEQTQAGIEIIGYPSIKAEIECILIGIGVLNALE-----IP 151
gi 16799653   80 TLPIGRVVSTT--GVTLPLKLSYSGKIFRAN-EDFGGEQNEQTQAGIEIIGYPSIKAEIECILSGIGVLNALE-----IP 151
gi 116871955  80 TLPIGRVVSTT--GVTLPLKLSYSGKIFRAN-EDFGGEQNEQTQAGIELVGYPSIKAEIECILSGIGVLNALE-----IP 151
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81299624  159 SWHLVVGEASLTRSLLQP--FPKDLREKVRQAIAQLDRVTLESLp------LESQLRDRALLLHDLRGqPDQVFAKLQQL 230
gi 237794905 157 NFKIELGEAGLFEALTENmrIEEENLKKLKEIIRNKNYVALKKFldeislkYSKEDFEIIENLPKLFG-DIEIIEKAKAL 235
gi 16802612  152 NFQIELGHAAIYRRVTNLlnLSETAEIDFRLLIQNKSLTGIKRFva----dNPSTLDDFILALPRLFGpATAILKQAKNL 227
gi 46906814  152 NFQIELGHAAIYRRVIQLlnLSETAEIDFRQLIQNKSLTGIKRFva----nNPSTLDDFILAIPRLFGpATAILNQAKSL 227
gi 217965337 152 NFQIELGHAAIYRRVIQLlnLSETAEIDFRQLIQNKSLTGIKRFva----nNPSTLDDFILAIPRLFGpATAILSQAKNL 227
gi 226223198 152 NFQIELGHAAIYRRVIQLlnLSETAEIDFRQLIQNKSLTGIKRFva----nNPSTLDDFILAIPRLFGpATAILNQAKSL 227
gi 284994035 152 NFQIELGHAAIYRRVTNLlnLSETAEIDFRLLIQNKSLTGIKRFva----dNPSTLDDFILVLPRLFGpATAILKQAKNL 227
gi 284800849 152 NFQIELGHAAIYRRVTNLlnLSETAEIDFRLLIQNKSLTGIKRFva----dNPSTLDDFILVLPRLFGpATAILKQAKNL 227
gi 16799653  152 NFQIELGHAAIYRRVIHLlnLPETAEMDFRLLIQNKSLTGIQQFvt----eNPSTLDDFILALPRLFGpATTILKQAKNL 227
gi 116871955 152 NFQIELGHAAIYRRVIHLlnLPETAEIDFRLLIQNKSLTGIQQFva----nNPSTLDDFILALPRLFGpAKAILKQAKNL 227
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81299624  231 TLTPLeQTLRDRLAQLVELYNASagPQDSPLLLDLSLLRSFDYYTGIVFEVVYETPTGPwvLAQGGRYDRLLDVYdpqAA 310
gi 237794905 236 TKNEKaLKSLNDIYNIYKSIEDI--GLGSYISIDLGMVQNIDYYTGVIFKGYVEEVGDS--ILSGGRYDNLIQHF---GI 308
gi 16802612  228 TTDKGiLTALREMETIVEAVSYT-----ADISVDLGLVQDFHYYTGIIFRGYADLAADN--FLSGGRYDHLLEQFt--SA 298
gi 46906814  228 TTDKGiLTALREMETIVEAVSYT-----ADISVDLGLVQDFHYYTGIIFRGYADLAADN--FLSGGRYDHLLEQFt--SS 298
gi 217965337 228 TTDKGiLTALHEMETIVEAVSYT-----ADISVDLGLVQDFHYYTGIIFRGYADLAADN--FLSGGRYDHLLEQFt--SS 298
gi 226223198 228 TTDKGiLTALREMETIVEAVSYT-----ADISVDLGLVQDFHYYTGIIFRGYADLAADN--FLSGGRYDHLLEQFt--SS 298
gi 284994035 228 TTDKGiLTALREMETIVEAVSYT-----ADISVDLGLVQDFHYYTGIIFRGYADLAADN--FLSGGRYDHLLEQFt--SA 298
gi 284800849 228 TTDKGiLTALREMETIVEAVSYT-----ADISVDLGLVQDFHYYTGIIFRGYADLAADN--FLSGGRYDHLLEQFt--SA 298
gi 16799653  228 TTDKGiLTALTEMETIVDAVSYA-----ADISVDLGLVQDFHYYTGIIFRGYADLAADN--FLSGGRYDHLLEQFt--SS 298
gi 116871955 228 TTDKGiLTALSEMETIVEAVSYT-----ADISVDLGLVQDFHYYTGIIFRGYADLAADN--FLSGGRYDHLLEQFt--SF 298
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81299624  311 GQPGIGFSCNIENLQQvLlaanRLPHRPPAIDQLVIPVDSEAYGAALAEAQRLQRQDQLRVELYLDsdRRpEVVQAFAQR 390
gi 237794905 309 ELPATGFAINVDDIMI-Alk-kQNTMSMDKDKKVLIFYKEEFLRKAYDFMQELKMKKIICELSLLDe-D--KEILLYSKK 383
gi 16802612  299 SSPAVGLALNLDSLTT-Lqn-rAGVIKKQVSTSLLIHYDLDAIQQAEKLMQETP--NSELSFFETP-----TNAISFAKK 369
gi 46906814  299 SSPAVGLALNLDSLTT-Lqn-rAGIIKKQTPTTLLIHYDLEALPQAEKFMQETP--NSELSFFETA-----SNAISFAKK 369
gi 217965337 299 SSPAVGLALNLDSLTT-Lqn-rAGIIKKQTPTTLLIHYDLEALQQAEKFMQETP--NSELSFFETA-----SNAISFAKK 369
gi 226223198 299 SSPAVGLALNLDSLTT-Lqn-rAGIIKKQTPTTLLIHYDLEALPQAEKFMQETPNS----ELSFFE--TA-SNAISFAKK 369
gi 284994035 299 SSPAVGLALNLDSLTT-Lqn-rAGVIKKQVSTSLLIHYDLDAIQQAEKLMQETPNS----ELSFFEt---pTNAISFAKK 369
gi 284800849 299 SSPAVGLALNLDSLTT-Lqn-rAGVIKKQVSTSLLIHYDLDAIQQAEKLMQETP--NSELSFFETP-----TNAISFAKK 369
gi 16799653  299 SSPAVGLALNLDSLTT-Lqn-rAGIIKKQTPTTLLIHYDLDAIQQAEKLMQETP--NSELSFFETP-----INAISFAKK 369
gi 116871955 299 SSPAVGLALNLDSLTT-Lqn-rAGIIKKQAPTILLIHYDLDALPQAEKLMQETP--NSELSFFDTS-----TNAISFAQK 369
                        410       420
                 ....*....|....*....|.
gi 81299624  391 RRIgrivwVSSGSAPQSEAVA 411
gi 237794905 384 KGIdfiigFTREEKLFVKDLK 404
gi 16802612  370 WHIpavihVSRQGIQTIFQRE 390
gi 46906814  370 WHIpevvhVSSQGIQTILQRE 390
gi 217965337 370 WHIpevvhVSSQGIQTIFQRE 390
gi 226223198 370 WHIpevvhVSSQGIQTIFQRE 390
gi 284994035 370 WHIpavihVSRQGIQTIFQRE 390
gi 284800849 370 WHIpavihVSRQGIQTIFQRE 390
gi 16799653  370 WQIptvvhVARDSIQTIFHKE 390
gi 116871955 370 WHIptvvhVSNQGIQTIFQKE 390
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap