Conserved Protein Domain Family
PRK12283

?
PRK12283: PRK12283 
tryptophanyl-tRNA synthetase; Reviewed
Statistics
?
PSSM-Id: 183401
View PSSM: PRK12283
Aligned: 75 rows
Threshold Bit Score: 744.464
Threshold Setting Gi: 296135807
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 171057428   1 MKSRVLSGMRPTGALHLGHYHGALKNWVRLQDDYDCFYFVADWHALTTHYEDREVIERNVYDMVIDWLAAGVDPERATLF 80
gi 77164551    7 QSQRVLSGMRPTGQLHLGHYHGVLKNWARLQHEYNCFFFVADWHALTTEYENPQVITDSVWDMVIDWLAAGIEPSAATLF 86
gi 292493546   7 QSQRVLSGMRPTGQLHLGHYHGVLKNWVQLQHEYNCFFFVADWHALTTEYENPQVITESVWDMVIDWLAAGIEPSAATLF 86
gi 300114575   7 QSQRVLSGMRPTGQLHLGHYRGVLKNWAQLQHEYNCFFFVADWHALTTEYENPQVITDSVWDMVIDWLAVGIEPSAATLF 86
gi 296135807  13 DDDRVLSGMRPTGALHLGHYHGALKNWAQLQNAHDCYFFVADWHALTTHYETPETIRAHTTEMVIDWLAAGVDPNKATLF 92
gi 218666020   1 MREIIVSGMRPTGRLHLGHYHGVLKNWLRLQEEAECYFFVADWHALTTHYETIQGISVAVWDLLIEWLAVGVDPDKAVLF 80
gi 198283583   1 MREIIVSGMRPTGRLHLGHYHGVLKNWLRLQEEAECYFFVADWHALTTHYETIQGISVAVWDLLIEWLAVGVDPDKAVLF 80
gi 256822103   1 --------MRPTGPLHLGHYHGVLKNWAQMQHEYECFFMVADWHALTTNYDDTARIEEYVWDTVLDWLAAGISPTAATIF 72
gi 148244475   2 QDRRVLSGMRPTGQLHLGHYHGVLKNWLVLQNEYDSYFFVADWHAFTTHYSDNMNLNVNVIEMVVDWLATGINPNTSTIF 81
gi 118602370   2 QDKRVLSGMRPTGQLHLGHYYGVLKNWLALQNEYDSYFFVADWHTFTTHYSDKIDLNTNVMKMVVDWLSVGINPNTSTIF 81
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 171057428  81 IQSRLPEHAELFTLLAMGTPLAWLERMPTYKDQMEKLKDRDLATYGFLGYPLLQAADILIYKAAYVPVGEDQAPHVEITR 160
gi 77164551   87 IQSKVPEHAELHLLLSMITPLGWLERVPTYKDQQEKLKEKDLATYGFLGYPLLQSADILVYKATRVPVGEDQVPHVEMSR 166
gi 292493546  87 IQSKVPEHAELHLLLSMVTPLGWLERVPTYKDQQEKLKEKDLATYGFLGYPLLQSADILIYRATKVPVGEDQVPHVEITR 166
gi 300114575  87 IQSKVPEHAELHLLLSMITPLGWLERVPTYKDQQEKLKEKDLATYGFLGYPLLQSADILVYKATRVPVGEDQVPHVEMSR 166
gi 296135807  93 VQSRVLEHAELFLLLGMGTPLSWLERVPTYKDQIANLKDKDLTTYGFLGYPLLQAADILIYLARYVPVGADQVPHIEMSR 172
gi 218666020  81 IQSHVPEHAELALLLGMLTPLSWLERVPTFKDQQEKLRERDLATFGFLGYPLLMTADILVYDAHKVPVGADQVAHLEISR 160
gi 198283583  81 IQSHVPEHAELALLLGMLTPLSWLERVPTFKDQQEKLRERDLATFGFLGYPLLMTADILVYDAHKVPVGADQVAHLEISR 160
gi 256822103  73 VQSKVPEHAELHLLLSMVTPLGWLERVPTYKEQQEKLQNKDLSTYGFLGYPLLQAADILVYRAGNVPVGADQVPHVEMTR 152
gi 148244475  82 VQSKVPEHSELHLLLSMSTPLSWLERVPSYKDQQLKLHIKDLATYGFLGYPLLQSADILIYKAGLVPVGEDQVAHVEFTR 161
gi 118602370  82 VQSKVPEHAELHLLLSMLTPLSWLERVPSYKDQQLKLSTKDLATYGFLGYPLLQSADILIYKAGLVPVGEDQVAHIELTR 161
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 171057428 161 EVARRFNHLYGRIPGFEQKIAAAIVRLGKDDARYYEKQRKAYGETGSAEAIAKGEAIVRKAaanvADWTEDETELLLGHL 240
gi 77164551  167 EITRRFNHLYGREPGFEELVEAAIKKMGKKNAQLYRELRRRFQEQGDVEALDKARAFLETQ----QNLTLGDRERLFGHL 242
gi 292493546 167 EIARRFNHLYGREPGFEELVEAAIKKMGKKNAQLYRELRRRFQEQGDVEALEKARAFLENQ----QNLTLGDRERLFGYL 242
gi 300114575 167 EITRRFNHLYGREPGFEELVEAAIKKMGKKNAQLYRELRRRFQEQGDVEALDKARAFLETQ----QNLTLGDRERLFGHL 242
gi 296135807 173 EIARRFNNLYGKDPAVEAQARAAAAKLPEDVRAQLAALRRAADQEGLTEKREQARELIAAS-----KLSRAEKDALRAQL 247
gi 218666020 161 ELARRFNSFYGRDADAATQVEKGLQVMGKRAAKTFLSLQQRFQQDGDALAVSEAVVFLGGQ----AGLSAEMREQLLAHL 236
gi 198283583 161 ELARRFNSFYGRDADAATQVEKGLQVMGKRAAKTFLSLQQRFQQDGDALAVSEAVVFLGGQ----AGLSAEMREQLLAHL 236
gi 256822103 153 EAARRFNHFYGKEPGFEEKVTEAIKKMGKKNAKLYNSLRKKFQEEGEQSALETAQALVESQ----ANISINDRERLYGYL 228
gi 148244475 162 EVARRFNHLYGREVDFEKKAEISINKMGKKQAKTYRLLRKTYQETGDDEALIKAHALLQQ-----QNITLGDRERLSGYI 236
gi 118602370 162 EVARRFNYLYGREVDFEEKAEIAISKMGKKQAKLYRSLRKVYQEIGNDDALIKAQALLQQQ----QNITLGDRERLLGYI 237
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 171057428 241 KGSGKTVLPEPQVLLTETAKLPGLDGAKMSKSYGNTIAMREEPAEVTRKIRGMKTDPQRGRRTDPGDPERCPVWQFHQVY 320
gi 77164551  243 EGEGKVILPEPQALLTPAARMPGLDGQKMSKSYGNTIALREPPEQVERKLRTMPTDPARVRRTDPGDPEKCPVWQFHRVY 322
gi 292493546 243 EGVGKTILPEPQALLTPAARMPGLDGQKMSKSYGNTIALREPPEQVEHKLRTMPTDPARVRRSDPGDPDKCPVWQFHLVY 322
gi 300114575 243 EGEGKVILPEPQALLTPAARMPGLDGQKMSKSYGNTIALREPPEQVERKLRTMPTDPARVRRSDPGDPEKCPVWQFHKVY 322
gi 296135807 248 SGGRRQILREPEALLTPESKLPGLDGRKMSKSYGNSIAIREERASVEHKIKRMPTDPARVKRTDPGTPERCPVWQFHLAY 327
gi 218666020 237 EGKGREILREPQALLTAASKMPGLDGQKMSKSYGNTIPLREAPEVVRKKIRTMPTDPARVARTDPGTPEKCPVWALHQVY 316
gi 198283583 237 EGKGREILREPQALLTAASKMPGLDGQKMSKSYGNTIPLREAPEVVRKKIRTMPTDPARVARTDPGTPEKCPVWALHQVY 316
gi 256822103 229 DGEGKIILPEPQALLTPVSKMPGLDGQKMSKSYGNAIAMREPRESVEKKIKTMPTDPARVRRTDPGTPEKCPVWEFHKIY 308
gi 148244475 237 EGIGRIILPEPELLLTKASKMPGLDGQKMSKSYCNTISLRDTPKQIQVKIKRMPTDPARIKIINTGNPQKCPVWKLHEVY 316
gi 118602370 238 EGVGKIVLPEPESLLTKASKMPGLDGQKMSKSYGNTISLRDTAEQIRAKIKHMPTDPARIKLTDIGNPQKCLVWQLHKVY 317
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 171057428 321 STPEVKDWVVQGCTSAGIGCLDCKQPVIDAVIAEQAPWRERAAAYLDEPKKVHWLVEAGTERARLVARQTMKDVRLAMGL 400
gi 77164551  323 SDDEVKEWVQKGCRTAGIGCLDCKQPIIDAIQSELKPIRERAQEYAHHPEEIQRIIKEGNEAAREVARETMAEVRQAMGL 402
gi 292493546 323 SNEEVKDWVQKGCRTAGIGCLDCKQPIVEAIQSELKPIRERAQEYARHPDEVQRIINEGNEAAREVARETMEEVRQAMGL 402
gi 300114575 323 SDEEVKGWVQKGCRTAGIGCLDCKQPIIDAIQSELKPIRERAQEYARHPEEVQRIIKEGNEAAREVARETMAEVRQAMGL 402
gi 296135807 328 TDDATRDWVQRGCTTAGIGCLECKQPVIDAILREQQPMFERAQPYLDNPALVHDILAHGSDKARATAQQTMHAVRDAMGL 407
gi 218666020 317 SGPETQAWVRNGCTTASIGCLDCKQPVIEAVLAEQAPIRERAEYWAARPQQLTEIAHAGAQRARQRAAQTLERVRAAMGL 396
gi 198283583 317 SGPETQAWVRNGCTTASIGCLDCKQPVIEAVLAEQAPIRERAEYWAARPQQLTEIAHAGAQRARQRAAQTLERVRAAMGL 396
gi 256822103 309 SSDEVKDWVQKGCTTAGIGCIDCKGPVIDSVCAEQQIFVERAKEYQESPEIVRNIVSEGSERARDVARETMDDVRQAMGL 388
gi 148244475 317 SNESTCDWVVEGCTKAKFGCIECKQPIINAIEEELTPMQERIAKYQSDPELIKQIIFEGSEKARSIAKETMIEVREAMGI 396
gi 118602370 318 SNKSTCDWVVEGCTKAKIGCVECKQPIINAIEEELTPIQERIAKYQADPGLIKQIIFEGSEKARSVAKETMIEVRKAMGI 397

                 ..
gi 171057428 401 AY 402
gi 77164551  403 SY 404
gi 292493546 403 SY 404
gi 300114575 403 SY 404
gi 296135807 408 KI 409
gi 218666020 397 AH 398
gi 198283583 397 AH 398
gi 256822103 389 SY 390
gi 148244475 397 NY 398
gi 118602370 398 NY 399
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap