Conserved Protein Domain Family
rlmL

?
PRK11783: rlmL 
23S rRNA m(2)G2445 methyltransferase; Provisional
Statistics
?
PSSM-Id: 236981
View PSSM: PRK11783
Aligned: 232 rows
Threshold Bit Score: 962.339
Threshold Setting Gi: 110833866
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
77458015    4 RFELFLTCPKGLEGLLIEEAVGLGLEEAREHTSAVRGMATMETAYRLCLWSRLANRVLLVLKRFPMKNAEDLYHGVLDVD 83 
56708023    3 KFTFFVSCAKGIELLLKDELERLGIS-SQEKLAGVEFEGSIKDAYKVCIYSYLASQVMLKVATDKVINQQDLYEFISSIN 81 
110670494   3 KFTFFVSCAKGIELLLKDELERLGIS-SQEKLAGVEFEGSIKDAYKVCIYSYLASQVMLKVATDKVINQQDLYEFISSIN 81 
134301838   3 KFTFFVSCAKGIELLLKDELERLGIS-SQEKLAGVEFEGSIKDAYKVCIYSYLASQVMLKVATDKVINQQDLYEFISSIN 81 
89256596    3 KFTFFVSCAKGIELLLKDELERLGIS-SQEKLAGVEFEGSIKDAYKVCIYSYLASQVMLKVATDKVINQQDLYEFISSIN 81 
115315025   3 KFTFFVSCAKGIELLLKDELERLGIS-SQEKLAGVEFEGSIKDAYKVCIYSYLASQVMLKVATDKVINQQDLYEFISSIN 81 
156502726   3 KFTFFVSCAKGIELLLKDELERLGIS-SQEKLAGVEFEGSIKDAYKVCIYSYLASQVMLKVATDKVINQQDLYEFISSIN 81 
187931616   3 KFTFFVSCAKGIELLLKDELERLGIS-SQEKLAGVEFEGSIKDAYKVCIYSYLASQVMLKVATDKVINQQDLYEFISSIN 81 
71278744    5 TQQFLALTSPGIEVLLFDEIKSLGAFNVIQKPEGVYFQASLALGYKISLWTRLATRIMLKLGEGEAKDKDELFKAASSIN 84 
56460390    1 MYRFFIACSKGLEGLLFDELQEFNLSHVKQTLAGCYIEADLQQAYTVAMWSRLASRMLLQLGEKEVSSLDEIKLALTQFS 80 
77458015   84 WQDHMLADGTLAVEFSGHGSGIDNTHFGALKVKDAIVDKLRTPQGDRPSIDKLNPDLRIHLRLDRGEAILSLDLSGHSLH 163
56708023   82 WMDYFAVDKTFKIIISGKHYDFNNTMFVSQKTKDAIVDQFRNVTNQRPNIDTENPDNVIKLHLHKQFVNVFLCLNIDSLH 161
110670494  82 WMDYFAVDKTFKIIISGKHYDFNNTMFVSQKTKDAIVDQFRNVTNQRPNIDTENPDNVIKLHLHKQFVNVFLCLNIDSLH 161
134301838  82 WMDYFAVDKTFKIIISGKHYDFNNTMFVSQKTKDAIVDQFRNVTNQRPNIDTENPDNVIKLHLHKQFVNVFLCLNIDSLH 161
89256596   82 WMDYFAVDKTFKIIISGKHYDFNNTMFVSQKTKDAIVDQFRNVINQRPNIDTENPDNVIKLHLHKQFVNVFLCLNIDSLH 161
115315025  82 WMDYFAVDKTFKIIISGKHYDFNNTMFVSQKTKDAIVDQFRNVINQRPNIDTENPDNVIKLHLHKQFVNVFLCLNIDSLH 161
156502726  82 WMDYFAVDKTFKIIISGKHYDFNNTMFVSQKTKDAIVDQFRNVINQRPNIDTENPDNVIKLHLHKQFVNVFLCLNIDSLH 161
187931616  82 WMDYFAVDKTFKIIISGKHYDFNNTMFVSQKTKDAIVDQFRNVTNQRPNIDTENPDNVIKLHLHKQFVNVFLCLNIDSLH 161
71278744   85 WPDIFKSTTTFAVDFVGYSEEIRNSQFGGLTIKDAIVDQFRDQGFERPNVDKKAPQISFQARLLRDNVTIFLDFSGRGLF 164
56460390   81 WSKVFDANRTFVVDFSGGNDDIRHTQFGAQLVKDCIVDNFRNSGFERPSIDKQDPDIRIAVRVHKDKLTWSLDFTGDGMH 160
77458015  164 QRGYRLQQGAAPLKENLAAAILIRSGWPRiaaEG-GALADPMCGVGTFLVEAGMIAADMAPNLRREQWGFTAWLGHVPAL 242
56708023  162 KRSYRQFQGQAPLKESLAAAILIKAGWLEelkKHqPILIDPMCGSGTILIEAALMAKNIAPVLLNKEFKIFNSKFHNQEL 241
110670494 162 KRSYRQFQGQAPLKESLAAAILIKAGWLEelkKHqPILIDPMCGSGTILIEAALMAKNIAPVLLNKEFKIFNSKFHNQEL 241
134301838 162 KRSYRQFQGQAPLKESLAAAILIKAGWLEelkKHqPILIDPMCGSGTILIEAALMAKNIAPVLLNKEFKIFNSKFHNQEL 241
89256596  162 KRSYRQFQGQAPLKESLAAAILIKAGWLEelkKHqPILIDPMCGSGTILIEAALMAKNIAPVLLNKEFKIFNSKFHNQEL 241
115315025 162 KRSYRQFQGQAPLKESLAAAILIKAGWLEelkKHqPILIDPMCGSGTILIEAALMAKNIAPVLLNKEFKIFNSKFHNQEL 241
156502726 162 KRSYRQFQGQAPLKESLAAAILIKAGWLEelkKHqPILIDPMCGSGTILIEAALMAKNIAPVLLNKEFKIFNSKFHNQEL 241
187931616 162 KRSYRQFQGQAPLKESLAAAILIKAGWLEelkKHqPILIDPMCGSGTILIEAALMAKNIAPVLLNKEFKIFNSKFHNQEL 241
71278744  165 QRGYREHSGAAPLKENLAAALIIRSGWLN---DTsKPLVDPMCGSGTILIEAVSMAAKQAPAINRQSWGFEAWLSHDNAV 241
56460390  161 KRGYRLQQGEAPLRETLAAAILVRAGIKNeleKDePVIFDPFCGSGTLVIEAAMMAMDHAPGLSRAHWGFLFWHEHSPQL 240
77458015  243 WKKLHEEAVERAAAGLAKPPLWIRGYEADPRLIQPGRNNVERAGLSEWIKIYQGEVATFEPRPDqnQKGLVICNPPYGER 322
56708023  242 WDNLLEIAKNSQKVTNA----IICGFDIDNNVLDKAQRNIYQAGVEDVITVKRQDIRDLENEFE--SEGLIVTNPPYGER 315
110670494 242 WDNLLEIAKNSQKVTNA----IICGFDIDNNVLDKAQRNIYQAGVEDVITVKRQDIRDLENEFE--SEGLIVTNPPYGER 315
134301838 242 WDNLLEIAKNSQKVTNA----IICGFDIDNNVLDKAQRNIYQAGVEDVVTVKRQDIRDLENEFE--SEGLIVTNPPYGER 315
89256596  242 WDNLLEIAKNSQKVTNA----IICGFDIDNNVLDKAQRNIYQAGVEDVVTVKRQDIRDLENEFE--SEGLIVTNPPYGER 315
115315025 242 WDNLLEIAKNSQKVTNA----IICGFDIDNNVLDKAQRNIYQAGVEDVVTVKRQDIRDLENEFE--SEGLIVTNPPYGER 315
156502726 242 WDNLLEIAKNSQKVTNA----IICGFDIDNNVLDKAQRNIYQAGVEDVVTVKRQDIRDLENEFE--SEGLIVTNPPYGER 315
187931616 242 WDNLLEIAKNSQKVTNA----IICGFDIDNNVLDKAQRNIYQAGVEDVVTVKCQDIRDLENEFE--SEGLIVTNPPYGER 315
71278744  242 WQKQLTLAIDSSEENMSNLKVKVFGIDIDERVLRTAQQNARNAQLHQYIEFTCKNTNDMDNTFG--QPGTILFNPPYGER 319
56460390  241 WHDVLEQAEQRFKEGKKNFKGHLKGSDNNPHLVAKAKDNAKRVLLHEVIEFEVADATNCEAPAE---SGLLVCNPPYGER 317
77458015  323 L--GDEASLLYLYQNLGERLRQACLNWEAAVFTGAPDLGKRMGIRSHKQYSFWNGALPCKLLLIKVLP------------ 388
56708023  316 LygDQLDELLDIFNGFGNRLSQDFYGWKVAVLTSFADSIKEMQLRTTERNKFYNGAIETILYQFEINEhakfkhetqlek 395
110670494 316 LygDQLDELLDIFNGFGNRLSQDFYGWKVAVLTSFADSIKEMQLRTTERNKFYNGAIETILYQFEINEhakfkhetqlek 395
134301838 316 LygDQLDELLDIFNGFGDRLSQDFYGWKVAVLTSFADSIKEMQLRTTERNKFYNGAIETILYQFEINEhakfkhetqlek 395
89256596  316 LygDQLDELLDIFNGFGDRLSQDFYGWKVAVLTSFADSIKEMQLRTTERNKFYNGAIETILYQFKINEhakfkhetqlek 395
115315025 316 LygDQLDELLDIFNGFGDRLSQDFYGWKVAVLTSFADSIKEMQLRTTERNKFYNGAIETILYQFKINEhakfkhetqlek 395
156502726 316 LygDQLDELLDIFNGFGDRLSQDFYGWKVAVLTSFADSIKEMQLRTTERNKFYNGAIETILYQFKINEhakfkhetqlek 395
187931616 316 LygDQLDELLDIFNGFGDRLSQDFYGWKVAVLTSFADSIKELQLRTTERNKFYNGAIETILYQFEINEhaqfkhetqlek 395
71278744  320 I--GELPELVENFVLFGQKLKMQFKDWRIAILTANVDLLSMLKLSSFKRYKFKNGPLDCQLALYNLDA------------ 385
56460390  318 L--GEAVETLLLYRRFGRQLKDTFQNWHIAVLAGDEQLLKRLKLRSHKKYPLLNGAIPVNLALYDLTK------------ 383
77458015  389 ------DQ---FVTGeRrtpeqrqaereqaaydqtpnepqerkfnkngnpikptpapapvieqprlsEGGQMFANRLQKN 459
56708023  396 niriaeAS---AQKS----------------------------------------------------DEHIDFANKLKKN 420
110670494 396 niriaeAS---AQKS----------------------------------------------------DEHIDFANKLKKN 420
134301838 396 niriaeAS---AQKS----------------------------------------------------DEHIDFANKLKKN 420
89256596  396 niriaeAS---AQKS----------------------------------------------------DEHIDFANKLKKN 420
115315025 396 niriaeAS---AQKS----------------------------------------------------DEHIDFANKLKKN 420
156502726 396 niriaeAS---AQKS----------------------------------------------------DEHIDFANKLKKN 420
187931616 396 niriaeAS---AQKS----------------------------------------------------DEHIDFANKLKKN 420
71278744  386 ------KQ---GAKDaInpqs-------------------------------------------dfaEEDSAFANRLKKN 413
56460390  384 ------EQpdfAE------------------------------------------------------SQADDLVNRVKKN 403
77458015  460 LKAMSKWVKREGIDCYRVYDADMPEYAMAIDLYHDWVHVQEYAAPKSIDPEKASIRMFDALAAIPQALNIDKSRVVVKRR 539
56708023  421 LKSLKPWLKQTGLECYRLYDADIPTFAVAVDVYSEHIFLQEYRADATIDQNIAKQRFYQAIYQIHKTLDIKYENIHTRVR 500
110670494 421 LKSLKPWLKQTGLECYRLYDADIPTFAVAVDVYSEHIFLQEYRADATIDQNIAKQRFYQAIYQIHKTLDIKYENIHTRVR 500
134301838 421 LKSLKPWLKQTGLECYRLYDADIPTFAVAVDVYSEHIFLQEYRADATIDQNIAKQRFYQAIYQIHKTLDIKYENIHTRVR 500
89256596  421 LKSLKPWLKQTGLECYRLYDADIPTFAVAVDVYSEHIFLQEYRADATIDQNIAKQRFYQAIYQIHKTLDIKYENIHTRVR 500
115315025 421 LKSLKPWLKQTGLECYRLYDADIPTFAVAVDVYSEHIFLQEYRADATIDQNIAKQRFYQAIYQIHKTLDIKYENIHTRVR 500
156502726 421 LKSLKPWLKQTGLECYRLYDADIPTFAVAVDVYSEHIFLQEYRADATIDQNIAKQRFYQAIYQIHKTLDIKYENIHTRVR 500
187931616 421 LKSLKPWLKQTGFECYRLYDADIPTFAVAVDVYSEHIFLQEYRADATIDQNIAKQRFYQAIYQIHKTLDIKYENIHTRVR 500
71278744  414 RKNLKGWLKSNEIEAYRLYDGDIPEYNVAIDIYGEYLVIQEYAAPKTIEEDKAKKRLQEVIYWAPKVLNIPTDKVILKTR 493
56460390  404 HAKLSKWANKEGLDCWRVYDADIPEYNAAIDIYQDYVVVQEYAAPKDIPEGVANDRLWFMLESLSSALPVSEDKIILKRR 483
77458015  540 ERQSGTKQYERQAAQGKFNEVTEGGVKLLVNLTDYLDTGLFLDHRPMRMRIQKEAAGKRFLNLFCYTATASVHAAKGGAR 619
56708023  501 QRQKGKEQYQKENDKNKFHIINEFDAKFYVNFDDYLDTGIFLDHRKIRQLVAKAAKNKTLLNLFSYTCTASVHAALKGAK 580
110670494 501 QRQKGKEQYQKENDKNKFHIINEFDAKFYVNFDDYLDTGIFLDHRKIRQLVAKAAKNKTLLNLFSYTCTASVHAALKGAK 580
134301838 501 QRQKGKEQYQKENDKNKFHIINEFDAKFYVNFDDYLDTGIFLDHRKIRQLVAKAAKNKTLLNLFSYTCTASVHAALKGAK 580
89256596  501 QRQKGKEQYQKENDKNKFHIINEFDAKFYVNFDDYLDTGIFLDHRKIRQLVAKAAKNKTLLNLFSYTCTASVHAALKGAK 580
115315025 501 QRQKGKEQYQKENDKNKFHIINEFDAKFYVNFDDYLDTGIFLDHRKIRQLVAKAAKNKTLLNLFSYTCTASVHAALKGAK 580
156502726 501 QRQKGKEQYQKENDKNKFHIINEFDAKFYVNFDDYLDTGIFLDHRKIRQLVAKAAKNKTLLNLFSYTCTASVHAALKGAK 580
187931616 501 QRQKGKEQYQKENDKNKFHIINEFDAKFYVNFDDYLDTGIFLDHRKIRQLVAKAAKNKTLLNLFSYTCTASVHAALKGAK 580
71278744  494 AKQRGANQYERLEKTKQSLTINEHGALFKINLWDYLDTGLFLDHRKTRQIVAKKSQGKSLLNLFAYTGSVSVQAAVQGAA 573
56460390  484 QRQSGKQQYERQSQDSTVLTVNEYGAKFEVNLTDYLDTGLFMDHRLVRKELLDKCEELDVLNLFAYTCTASVQAARAGAA 563
77458015  620 STTSVDLSKTYLDWARRNLSLNGFS-DKNRLEQGDVMAWLENC--REEYDLIFIDPPTFSNSKRMEGIFDVQRDQVQLID 696
56708023  581 -TTSVDMSNTYLEWGKNNFTLNNIDaKKHSFIQADCISWLKTN--KDKFDVIFLDPPTFSNSKRMDDILDIQRDHELLIN 657
110670494 581 -TTSVDMSNTYLEWGKNNFTLNNIDaKKHSFIQADCISWLKTN--KDKFDVIFLDPPTFSNSKRMDDILDIQRDHELLIN 657
134301838 581 -TTSVDMSNTYLEWGKNNFTLNNIDaKKHSFIQADCISWLKTN--KDKFDVIFLDPPTFSNSKRMDDILDIQRDHELLIN 657
89256596  581 -TTSVDMSNTYLEWGKNNFTLNNIDaKKHSFIQADCISWLKTN--KDKFDVIFLDPPTFSNSKRMDDILDIQRDHELLIN 657
115315025 581 -TTSVDMSNTYLEWGKNNFTLNNIDaKKHSFIQADCISWLKTN--KDKFDVIFLDPPTFSNSKRMDDILDIQRDHELLIN 657
156502726 581 -TTSVDMSNTYLEWGKNNFTLNNIDaKKHSFIQADCISWLKTN--KDKFDVIFLDPPTFSNSKRMDDILDIQRDHELLIN 657
187931616 581 -TTSVDMSNTYLEWGKNNFTLNNINaKKHSFIQADCISWLKTN--KDKFDVIFLDPPTFSNSKRMDDILDIQRDHELLIN 657
71278744  574 SITTVDMSNTYLNWAEDNFALNKLNgHKYQFIQADCLDWLKKN--VNKFDVIFIDPPTFSNSKRMEDSFDVQRDHVDLIT 651
56460390  564 RVVSVDMSKTYLKWGERNFALNRLR-GDYQFIQADCFIWMREQrgKQLFDVIFLDPPTFSNSKRMSGTLDIQRDHVGLIK 642
77458015  697 LAMARLASGGVLYFSNNFRKFQLEDNLAER--YAVEEITASTIDPDFARNGKIHRAWKITA 755
56708023  658 LAMDSLKKDGILYFSNNYRRFKMSPQILEK--FNCENIDKICLSRDFLSNKNIHNCWEIKY 716
110670494 658 LAMDSLKKDGILYFSNNYRRFKMSPQILEK--FNCENIDKICLSRDFLSNKNIHNCWEIKY 716
134301838 658 LAMDSLKKDGILYFSNNYRRFKMSPQILEK--FNCENIDKICLSRDFLSNKNIHNCWEIKY 716
89256596  658 LAMDSLKKDGILYFSNNYRRFKMSPQILEK--FNCENIDKICLSRDFLSNKNIHNCWEIKY 716
115315025 658 LAMDSLKKDGILYFSNNYRRFKMSPQILEK--FNCENIDKICLSRDFLSNKNIHNCWEIKY 716
156502726 658 LAMDSLKKDGILYFSNNYRRFKMSPQILEK--FNCENIDKICLSRDFLSNKNIHNCWEIKY 716
187931616 658 LAMDSLKKDGILYFSNNYRRFKMSPQILEK--FNCENIDKICLSRDFLSNKNIHNCWEIKY 716
71278744  652 DALKSLNRGGEIFFTNNKRNFKIDFEALDElgLTAEAMSDVTRDKDFARNKHIHNSWSIKR 712
56460390  643 TATGMLKEDGVILFSNNRKKFRIDTEGLDKagLEVNDQTQASIPEDFKRHKGIHHYYIISR 703
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap