Conserved Protein Domain Family
ssuB

?
PRK11247: ssuB 
aliphatic sulfonates transport ATP-binding subunit; Provisional
Statistics
?
PSSM-Id: 183055
View PSSM: PRK11247
Aligned: 86 rows
Threshold Bit Score: 472.625
Threshold Setting Gi: 24112342
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 161484911   1 MTTLTHIPQGTPITLESIGKRYGNRTVLDNLQLRITAGQFVAVVGRSGCGKSTLLRLLAGLEAASDGTLLSGNALLSHAK 80
gi 226945115   1 MSALHNLKNGIPLGIEGIHKSFGERQVLKAIDLHIPAGQFVAVVGRSGCGKSTLLRLLAGLDAPSGGALLAGQVPLAQAR 80
gi 28872426    5 KQQPPHLLRGIPLAVQNLKKAFGTREVLKDIDLHIPAGQFVAIVGRSGCGKSTLLRLLAGLDKPTEGQLLAGSAPLDDAR 84
gi 66048098    5 KQQPPHLLRGIPLAVRKLKKAFGAREVLKDIDLHIPAGQFVAIVGRSGCGKSTLLRLLAGLDKPTQGQLLAGSAPLDDAR 84
gi 170724129   5 KEQPPRLLRGIPLAANGLRKTFGQREVLRGIDLHIPAGQFVAIVGRSGCGKSTLLRLLAGLDQPGAGELLAGAAPLAEAR 84
gi 77461632    3 AQQPPRLLRGIPLAVRNLQKTFGSRQVLRGIDLHIPAGQFVAVVGRSGCGKSTLLRLLAGLDQPTGGDLLAGSAPLTDAR 82
gi 229593223   3 AQQPPRLLKGIPLAVRKLRKAFGAREVLKDIDLHIPAGQFVAVVGRSGCGKSTLLRLLAGLDKASGGELLAGSAPLSEAI 82
gi 71737656    5 KQQPPHLLRGIPLAVRNLKKAFGTREVLKDIDLHIPAGQFVAIVGRSGCGKSTLLRLLAGLDKPTEGQLLAGSAPLDDAR 84
gi 70733219    3 AQQPPRLLQGIPLAVRKLQKTFGSRQVLREIDLHIPAGQFVAVVGRSGCGKSTLLRLLAGLDQPSAGELLAGSAPLSAAI 82
gi 104779507   5 KEQPPRLLRGIPLAANDLRRTFGQREVLRGVDLHIPAGQFVAIVGRSGCGKSTLLRLLAGLDQPSGGELLAGAAPLAEAR 84
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 161484911  81 DETRLMFQEARLLPWKKVIDNVGLGLRGHWRDEALQVLDTVGLADRANEWPAALSGGQKQRVALARALIHRPRLLLLDEP 160
gi 226945115  81 EDTRLMFQDARLLPWKRVIDNVGLGLSGDWRPRAEEALAEVGLAERAGEWPAALSGGQKQRVALARALIHRPRLLLLDEP 160
gi 28872426   85 EDTRLMFQEARLLPWKKVIDNVGLGLGGNWRPQALEALEAVGLAERANEWPAALSGGQKQRVALARALIHKPRLLLLDEP 164
gi 66048098   85 EDTRLMFQEARLLPWKKIIDNVGLGLSGDWRAQALEALEAVGLAERANEWPAALSGGQKQRVALARALIHKPRLLLLDEP 164
gi 170724129  85 EDTRLMFQDARLLPWKKVIDNVGLGLSGHWRPRALEALEAVGLADRANEWPAALSGGQKQRVALARALIHQPRLLLLDEP 164
gi 77461632   83 DDTRLMFQEARLLPWKKIIDNVGLGLKGNWRAQALQALDAVGLADRANEWPAALSGGQKQRVALARALIHQPRLLLLDEP 162
gi 229593223  83 EDTRLMFQEARLLPWKKIIDNVGLGLKGNWRPKALEALEAVGLAERANEWPAALSGGQKQRVALARALIHQPRLLLLDEP 162
gi 71737656   85 EDTRLMFQEARLLPWKKIIDNVGLGLSGDWRAQALEALEAVGLAERANEWPAALSGGQKQRVALARALIHKPRLLLLDEP 164
gi 70733219   83 EDTRLMFQEARLLPWKKVIDNVGLGLKGNWRPQALQALEAVGLADRAQEWPAALSGGQKQRVALARALIHQPRLLLLDEP 162
gi 104779507  85 EDTRLMFQDARLLPWKKVIDNVGLGLSGNWRPRALEALDAVGLAERAHEWPAALSGGQKQRVALARALIHQPRLLLLDEP 164
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 161484911 161 LGALDALTRIEMQGLIERLWQQHGFTVLLVTHDVSEAIALADRVLLIEEGRIGLDLAIDLPRPRRKGSAKLAALEAEVLE 240
gi 226945115 161 LGALDALTRIEMQQLIERLWQQHGFTVLLVTHDVSEAVAVADRVILIEEGRIGLDLPVDLPRLRSRGSARLAALEAEVLE 240
gi 28872426  165 LGALDALTRIEMQQLIEKLWGQYGFTVLLVTHDVSEAVAIADRVILIEEGQIGLDLLVDLPRPRARGSHRLAALEAEVLN 244
gi 66048098  165 LGALDALTRIEMQQLIEKLWGQYGFTVLLVTHDVSEAVAIADRVILIEEGQIGLDLLVDLPRPRVRGSHRLAALEAEVLN 244
gi 170724129 165 LGALDALTRIEMQHLIERLWRQHGFTVLLVTHDVNEAIAVADRVILIEDGAVGLDLNVDLARPRVRGSHRLAALESEVLN 244
gi 77461632  163 LGALDALTRIEMQQLIERLWQQHGFTVLLVTHDVSEAVAIADRVILIEDGEVGLDLPVELPRPRVRGSHRLAALETEVLN 242
gi 229593223 163 LGALDALTRIEMQQLIENLWQKHGFTVLLVTHDVSEAVAIADRVILIEDGEIGLDLIVDLPRPRARGSHRLAALEAEVLN 242
gi 71737656  165 LGALDALTRIEMQQLIEKLWHQYGFTVLLVTHDVSEAVAIADRVILIEEGQIGLDLLVDLPRPRVRGSHRLAALEAEVLN 244
gi 70733219  163 LGALDALTRIEMQQLIERLWQQHGFTVLLVTHDVSEAVAIADRVILIEDGEVGLDLHVELPRPRVRGSHRLAALETEVLN 242
gi 104779507 165 LGALDALTRIEMQQLIERLWRQHGFTVLLVTHDVSEAVAVADRVILIEDGAVGLDLVVDLPRPRVRGSHRLAALESEVLN 244
                        250       260       270
                 ....*....|....*....|....*....|.
gi 161484911 241 RVLSPPQGIeasrqgikasrqgtATSRRVAN 271
gi 226945115 241 RVLAPAAAPpne---------sePRSERSAG 262
gi 28872426  245 RVLAIPGSPpdpep-----fsplPTQLSWAN 270
gi 66048098  245 RVLALPGSPpdpep-----fsplPTQLRWAN 270
gi 170724129 245 RVLSAPGTApepdp-----vaplPTQLRWAH 270
gi 77461632  243 RVLSLPGEPpapep-----vsplPTQLRWAQ 268
gi 229593223 243 RVLSLPGTPpepep-----vsplPTQLRWAQ 268
gi 71737656  245 RVLALPGSPpdpep-----fsplPTQLRWAN 270
gi 70733219  243 RVLSLPGSPpepep-----vsplPTQLRWAL 268
gi 104779507 245 RVLSVPGTPpepep-----vaplPTHLRWAH 270
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap