Conserved Protein Domain Family
fecE

?
PRK11231: fecE 
iron-dicitrate transporter ATP-binding subunit; Provisional
Statistics
?
PSSM-Id: 183044
View PSSM: PRK11231
Aligned: 33 rows
Threshold Bit Score: 470.265
Threshold Setting Gi: 15601993
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16132108    1 MTLRTENLTVSYGTDKVLNDVSLSLPTGKITALIGPNGCGKSTLLNCFSRLLMPQSGTVFLGDNPINMLSSRQLARRLSL 80
gi 156977224   1 -MLKTHQLSVSYGKENIIHNLDLDIPEGKITALIGPNGSGKSTLLKTLCRINKQFDGSLTVYDKSIKDYADKELSRYISL 79
gi 262396369   1 -MLRTQNLSVAYGKQTIIPDLSLSIPQGKITALVGPNGCGKSTLLKTLVRINKPASGQVLYDDKPLSSYGDKRLARSLSL 79
gi 218676882   3 TMLKTQNLSVAYGKQTIIPNLSVSIPKGKITALIGPNGCGKSTLLKTLVRINKPVTGEVLFEDKPLSSYGDKVLARSLSL 82
gi 261867509   1 MSIVINNLQLGYQNKIIVQDLSLDFPHNQVIALIGPNGCGKSTTLKAIARLLKPRTGKITHHGKDIWQSTPKEYAKALSF 80
gi 66043931    2 TILKAQQLDIGYGATRIVQDLSFSPPPAQVTALIGPNGCGKSTLLKAFARILTPQAGSLSLDGTAYGKLSANELARKVAF 81
gi 28901507    1 -MLRTQNLSVAYGKQTIIPDLSLSIPQGKITALVGPNGCGKSTLLKTLVRINKPASGEVLYDDKPLSNYGDKRLARSLSL 79
gi 71738165    2 SILKAQQLDIGYGATRIVQDLSFSPPPAQVTALIGPNGCGKSTLLKAFARILTPQSGSLSLDGKAYSQLSAKELARKVAF 81
gi 28867988    2 SILKAQHLDIGYGATRIVQDLSFSPPAGQVTALIGPNGCGKSTLLKAFARILTPQSGSLSLDGKGYSQLSARELACKVAF 81
gi 251793015   1 MSIEINKLQLGYQDKTIVRDLSLSFPSNQIIALIGPNGCGKSTTLKAVARLLKPRLGTITHKGKDIWQSTPKEYAKQLAF 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16132108   81 LPQHHLTPEGITVQELVSYGRNPWLSLWGRLSAEDNARVNVAMNQTRINHLAVRRLTELSGGQRQRAFLAMVLAQNTPVV 160
gi 156977224  80 LPQVLTTPEDITVRRLVEYGRSPYLSYWGRLTQDDHEKVDKAIAATQIEELVDKKVDALSGGQRQRVWIAMVLAQDTPIV 159
gi 262396369  80 LPQILVSPEGITVRKLVEYGRSPYLSHWGRLSQQDKALVEQAMQDTGVIEFADQPVESLSGGQRQRAWIAMVMAQDTDVV 159
gi 218676882  83 LPQILVSPEGISVRKLVEYGRSPYVSHWGRLGQEDQAIVEQAMHDTGVLEFADKPIESLSGGQRQRAWIAMIIAQDTDVV 162
gi 261867509  81 LPQQHLVPEGIKVRELIAYGRSPYLNLWGKLNDKDEALVTWSMEQTHTTELANRLVSDLSGGQQQRVFLAMTLAQDAELV 160
gi 66043931   82 LPQVLPIPEGVSVRQLVAYGRSPHNSLWGRLSGADQHSVDQALQRMELDTLAERPLSDLSGGQRQRAWLAMILAQDAAIV 161
gi 28901507   80 LPQILVSPEGITVRKLVEYGRSPYLSHWGRLSQQDKALVEQAMQDTGVIEFADKPVESLSGGQRQRAWIAMVMAQDTDVV 159
gi 71738165   82 LPQVLPIPEGVSVRQLVAYGRSPHNSMWGRLSGADQHSVEQALQRMELETLAERPLSDLSGGQRQRAWLAMILAQDAAIV 161
gi 28867988   82 LPQVLPIPEGVNVRQLVAYGRSPHNSLWGRLSGADQHSVDQALQRMELATLAERPLSDLSGGQRQRAWLAMILAQDAAIV 161
gi 251793015  81 LPQQHLVPEGIKVRELIAYGRSPYLNLWGKLSDKDEQLVAWAMEQTHTTELAEHLVSDLSGGQQQRVFLAMTLAQDAELV 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16132108  161 LLDEPTTYLDINHQVDLMRLMGELRTQGKTVVAVLHDLNQASRYCDQLVVMANGHVMAQGTPEEVMTPGLLRTVFSVEAE 240
gi 156977224 160 MLDEPTTYLDLSHQVELMKLIQKLNAAGKTVIVVLHDLNQACRYCDHLVVLKKGQVTHKGAPEEIFTQSLLKDVFDLDAM 239
gi 262396369 160 MLDEPTTYLDLSHQVELMKLMRQMNDKGKTVVVVLHDLNQACRYCDHLVVLEKGQLVTQGTPQEVLTEGMLASVFDLQAR 239
gi 218676882 163 MLDEPTTYLDMSHQVELMNLMQQMNDKGKTVVVVLHDLNQASRYCDHLIVLERGGLVAEGTPDEVMTERLLNDVFDLKAS 242
gi 261867509 161 LLDEPTTYLDLNRQAELMGMMRQMQQNGKTVITVLHDLNQACRYCDYLVVLKDGNLMAKGTPDEVMSEELLKTVFDLDVE 240
gi 66043931  162 LLDEPTTYLDISHQVELLDLMRELSAEGKTVITVLHDINQACRYADHLAVMQGGRMVTCGAPSDVLTAELVCQVFDVQVQ 241
gi 28901507  160 MLDEPTTYLDLSHQVELMKLMRQMNDKGKTVVVVLHDLNQACRYCDHLVVLEKGQLVTQGTPQEVLTEGMLASVFDLQAR 239
gi 71738165  162 LLDEPTTYLDISHQVELLDLMRELSAEGKTVITVLHDINQACRYADHLAVMQGGRLVTCGAPGEVLTAELVCQVFDVQVQ 241
gi 28867988  162 LLDEPTTYLDISHQVELLDLMRELSAEGKTVITVLHDINQACRYADHLAVMQGGRLVTCGAPGDVLTAELVCQVFDVHVQ 241
gi 251793015 161 LLDEPTTYLDLNRQAELMGMMRQMQQNGKTVITVLHDLNQACRYCDYLIVLKDGNLMAQGTPDEVMTERLLKEVFDLEVV 240
                        250
                 ....*....|....*
gi 16132108  241 IHPEPVSGRPMCLMR 255
gi 156977224 240 IMNDPVSNKPMCINL 254
gi 262396369 240 VFNDPISGTPMCVAV 254
gi 218676882 243 VFRDPISNTPMCVAI 257
gi 261867509 241 IHRDPVSQTPMFILK 255
gi 66043931  242 IMREPVAGTPMCIVE 256
gi 28901507  240 VFNDPISGTPMCVAV 254
gi 71738165  242 IMREPVAGTPMCIVE 256
gi 28867988  242 IMREPVAGTPMCIVE 256
gi 251793015 241 IHRDPISQTPMFILK 255
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap