Conserved Protein Domain Family
rrmJ

?
PRK11188: rrmJ 
23S rRNA methyltransferase J; Provisional
Statistics
?
PSSM-Id: 183025
View PSSM: PRK11188
Aligned: 146 rows
Threshold Bit Score: 412.204
Threshold Setting Gi: 71279764
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 152972103   1 MTGKKRSASSSRWLQEHFSDKYVQQAQKKGLRSRAWFKLDEIQQSDKIFKPGMTVVDLGAAPGGWSQYAVTQIGNSGRII 80
gi 209694183   1 MSKNKLSASSGRWLKEHFDDKYVLEAQKRGYRSRAIFKLEEIQNKDKLLKPGMTVVDLGAAPGGWSQYAVEQVGDSGQVI 80
gi 262393375   1 MSKQKHSASSGRWLKEHFDDKYANEARKKGYRSRAYFKIDEIQTKDKLLKPGMTVVDLGAAPGGWSQYAAKIVGDSGQII 80
gi 77359818    1 MTNKKQSASSQRWLKEHFDDKYVQEAQKKGWRSRAVFKLDEVQSRDKLLRPAMTVVDLGAAPGSWSQYLAEKVGDKGQVI 80
gi 156975670   1 MSKQKHSASSGRWLKEHFDDKYANEARKKGYRSRAYFKIEEIQTKDKLLKSGMTVVDLGAAPGGWSQYAAKIIGEEGQII 80
gi 54307808    1 MSRNKQSASSGRWLKEHFDDKYVQEAQKRGYRSRAIFKIEEIQKKDKLLKPGMTVVDLGAAPGGWSQYAAEVVGDEGQVI 80
gi 59711085    1 MSKNKVSASSGRWLKEHFDDKYVLEAQKRGYRSRAIFKIEEIQNKDKLLKPGMTVVDLGAAPGGWSQYAVEQVGDEGQVI 80
gi 71279764    1 MANKKHKASSQRWLDEHFDDEYVKKAQRLGLRSRAVFKLEEINIKDRLIKPGMKVVDLGAAPGGWSEYAVKVVGDKGQVV 80
gi 218710452   1 MSKQKHSASSGRWLKEHFDDKYANEARKKGYRSRAYFKMEEIQTKDKLLTPGMTIVDLGAAPGGWSQYAAKIIGDNGQII 80
gi 197334812   1 MSKNKVSASSGRWLKEHFDDKYVLEAQKRGYRSRAIFKIEEIQNKDKLLKSGMTVVDLGAAPGGWSQYAVEQVGDEGQVI 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 152972103  81 ACDLLPMDPIVGVDFLQGDFRDELVLKALLERVGDSKVQVVMSDMAPNMCGTPAVDIPRAMYLVELALEMSRDVLAPGGS 160
gi 209694183  81 ACDILAMDSIAGVSFLQGDFREEAVLDALLERIQPDMVDVVMSDMAPNMSGNPSVDQPRSMYLVELALDMCRQVLAPNGS 160
gi 262393375  81 ACDLLPMDPIAGVSFLQGDFRDDAVLEALLERIQPSMVDVVMSDMAPNIAGNNSVDQPRAMYLVELALDMCRQVLAPNGS 160
gi 77359818   81 ACDILPMDSLAGVDFLQGDFREEAVLSALLKRIDGKNVDVVLSDMAPNMSGNNSVDQAGSMYLVELALDMCNQVLKKNGA 160
gi 156975670  81 ACDLLPMDPIAGVSFLQGDFRDEAVLDALLERIQPSMVDVVMSDMAPNIAGNNSVDQPRAMYLVELALDMCRQVLAPNGS 160
gi 54307808   81 ACDILSMDSLPGVSFLQGDFREEAVLSALLERIQPDMVDVVLSDMAPNMSGNLASDQPRAMYLVELALEMCKQVLAPNGS 160
gi 59711085   81 ACDILPMDSIAGVSFLQGDFREEAVLDALLERIQPDMVDVVMSDMAPNMSGNLAVDQPRAMYLVELALDMCRQVLAPNGS 160
gi 71279764   81 ACDILPMDAIVGVDFLEGDFREEEVLDALLTRINGKNIDVVMSDMAANMTGNESADSARSMYLVELALDMCSQVLKPNGA 160
gi 218710452  81 ACDLLPMDPIAGVSFLQGDFREEAVLDALLERIQPNMVDVVMSDMAPNIAGNNSVDQPRAMYLVELALDMCRQVLATNGS 160
gi 197334812  81 ACDILPMDSIAGVSFLQGDFREEAVLDALLERIQPDMVDVVMSDMAPNMSGNLAVDQPRAMYLVELALDMCRQVLAPNGS 160
                        170       180       190       200
                 ....*....|....*....|....*....|....*....|....*....
gi 152972103 161 FVVKVFQGEGFDEYLREIRSLFTKVKVRKPDSSRARSREVYIVATGRKP 209
gi 209694183 161 FTVKVFQGESFDAYLQEVRKVFKVVKIRKPDSSRARSREVYIVATGYKG 209
gi 262393375 161 FVVKVFQGEGFDQYVKEVRDMFKAVKIRKPDSSRARSREVFVVATGYKG 209
gi 77359818  161 FIVKVFQGEGFDQFLQDVRNSFKTVKIRKPDASRARSREVYIVATGYKL 209
gi 156975670 161 FVVKVFQGEGFDQFVKEVRDMFKVVKIRKPDSSRARSREVFVVATGYKG 209
gi 54307808  161 FAVKVFQGEGFDQYLAEIRNMFKVVKIRKPDSSRDRSREVYIVATGYKL 209
gi 59711085  161 FTVKVFQGEGFDQYLQEVRNMFKVVKIRKPDSSRARSREVYIVATGYKG 209
gi 71279764  161 FVVKVFQGAGFEDYMKATRAVFKAVKTRKPESSRARSREVYLVATGYKG 209
gi 218710452 161 FVVKVFQGEGFDQYVKDVREMFKTVKVRKPDSSRARSREVFIVATGYKG 209
gi 197334812 161 FTVKVFQGEGFDQYLQEVRNMFKVVKIRKPDSSRARSREVYIVATGYKG 209
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap