Conserved Protein Domain Family
nagA

?
PRK11170: nagA 
N-acetylglucosamine-6-phosphate deacetylase; Provisional
Statistics
?
PSSM-Id: 183010
View PSSM: PRK11170
Aligned: 125 rows
Threshold Bit Score: 673.996
Threshold Setting Gi: 33519782
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 290476162   1 MYALTNCVIYTGYERLDNHAVIIADDLIQHVCPVNELPEHIEKHDLQGANLSPGFIDLQVNGCGGVQFNErleDLTEDTL 80
gi 16272107    2 KYALINCVIYTKYDVLRDFAVIINGEIIEAVIPQAELETGIKTIDLQGNNLTAGFIDLQLNGCGGVMFND---QTSVETL 78
gi 68248748    2 KYALTNSVIYTKYEILRDYAVVIDSETIEAVIPQAELETGIKTIDLQGNNLTAGFIDLQLNGCGGVMFND---QTSVETL 78
gi 148825592   2 KYALINCVIYTKYDVLRDFAVIINGEIIEAIVPQAELETGIKTIDLQGNNLTAGFIDLQLNGCGGVMFND---QTSVETL 78
gi 148827281   2 KYALTNSVIYTKYEILRDYAVVIDGETIEAVIPQTELEKDIKTIDLQGNNLTAGFIDLQLNGCGGVMFND---QTSVETL 78
gi 15602739    1 MYAFVNAVIYTAKDVLYGKALVVDGDKISAILPVEDVPENLQKIDLQGNNLTAGFIDLQLNGCGGVMFNE---DISVKTL 77
gi 113461169   2 KYAFINCVIYTAKEVLYGHAVVVENDKISAIVSEKQLCNEIQRIDLKGNNLTAGFIDLQLNGCGGVMFNE---DISVRTL 78
gi 170717757   2 KYAFINCVIYTAKEVLYGHAVVVENDKISAIVSEEQLCNEIQRIDLKGNNLTAGFIDLQLNGCGGVMFNE---DISVRTL 78
gi 251792325   2 KYALINSVIYTKYDILRDYAVVINGENIEAVIPQSELESDIKTIDLQGHNLTAGFIDLQLNGCGGVMFND---QTSVETL 78
gi 261868240   2 KYALTNSVIYTKYEVLRDYAVVIEGEHIQAVVLQSELERDIKTIDLQGHNLTAGFIDLQLNGCGGVMFND---QTSVETL 78
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 290476162  81 NIMQKTNQRYGCTSFLPTLITSPDELMITAIEVMRSYLTKHPNQALGLHLEGPYINPIKKGTHNPAYIRKPTSEMVNYLC 160
gi 16272107   79 EIMQETNLKSGCTSFLPTFITAPDENIKSAVKIMREYLNKHKNQALGLHIEGPYLSIEKKGVHRPEYIREITPEMKDFLC 158
gi 68248748   79 EIMQETNLKSGCTSFLPTFITAPDENIKSAVKIMREYLNKHKNQALGLHIEGPYLSIEKKGVHRPEYIREITPEMKDFLC 158
gi 148825592  79 EIMQETNLKSGCTSFLPTFITAPDENIKSAVKIMREYLNKHKNQALGLHIEGPYLSIEKKGVHRPEYIREITPEMKDFLC 158
gi 148827281  79 EIMQETNLKSGCTSFLPTFITAPDENIKSAVKIMREYLNKHKNQALGLHIEGPYLSIEKKGVHRPEYIREITPEMKDFLC 158
gi 15602739   78 EIMQETNLKSGTTSYLPTFITSPDEGMKDAVKVMREYLTQYKNQALGLHFEGPYLSVEKKGVHREEYIRAISPEMKTFLC 157
gi 113461169  79 EIMQETNLRSGTTSYLPTFITSPDEGMKSAVQVMRDYLEKYQNQALGLHLEGPYLSVERKGVHRDEYIREITPEMKSFLC 158
gi 170717757  79 EIMQETNLRSGTTSYLPTFITSPDEGMKSAVQVMRDYLEKYQNQALGLHLEGPYLSVERKGVHRDEYIREITPEMKSFLC 158
gi 251792325  79 EIMQATNLKSGCTSFLPTFITAPDEGIKSAVKIMREYLAKHKNQALGLHIEGPYLSVEKKGVHRPEYIREISPEMKDFLC 158
gi 261868240  79 EIMQTTNLKSGCTSFLPTFITAPDEGIKSAVKIMREYLAKHKNQALGLHIEGPYLSVEKKGVHRPEYIREISPEMKDFLC 158
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 290476162 161 INADVITKITLAPEIVESKYIHQLTEAGIIVSAGHSNATYEEARHGFQHGISFSTHLYNAM-PAISGRQPGLISAIYDsS 239
gi 16272107  159 ENGDVITKMTIAAENPTINYTPDFVKAGIIVSVGHSNATYEVAKAAFHKGATFATHLHNAMsPISSGREMGVVGAVLD-S 237
gi 68248748  159 ENGDVITKITIAAENPTINYTPDFVKAGIIVSVGHSNATYEVAKAAFHKGATFATHLHNAMsPISSGREMGVVGAVLD-S 237
gi 148825592 159 QNGDVITKMTIAAENPTINYTPDFVKAGIIVSVGHSNATYEVAKAAFHKGATFATHLHNAMsPISSGREMGVVGAVLD-S 237
gi 148827281 159 ENSDVITKITIAAENPTINYTPDFVEAGIIVSVGHSNASYEVAKAAFHKGATFATHLHNAMsPISSGREMGVVGAVLD-S 237
gi 15602739  158 DNADVITKITLAAENPTAQYIPDFVEKGIIVSLGHSNATYDVAQQAIEKGASFATHLHNAMsPISSGRAMGVVGAVLD-S 236
gi 113461169 159 DNADVITKITLAAENPTAKHIPEFVKNGILVSLGHSNASYEVAKKAIQLGAGFATHLHNAMsPISSGRAMGVVGAVLD-S 237
gi 170717757 159 DNADVITKITLAAENPTAKHIPEFVKNGILVSLGHSNASYEVAKKAIQLGAGFATHLHNAMsPISSGRAMGVVGAVLD-S 237
gi 251792325 159 DNADVITKLTIAAENPTINYTPDFVKSGIVVSVGHSNASYEVAKAAFHKGATFATHLHNAMsPISSGRAMGVVGAVLD-S 237
gi 261868240 159 ENADVITKLTIAAENPTANYIPDFVKSGIVVSIGHSNATYEVAKAAFHKGATFATHLHNAMsPISSGRAMGVVGAVLD-S 237
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 290476162 240 EVYAGIICDGMHVSWPNIRNSKRLKTDKLILVTDAIVPAGldpktNTLEQFTFANKTIYYRNGLCVDENGTLSGSSITMI 319
gi 16272107  238 DVYTGIIVDGVHINYGNVRIDKKIKGDKLCIVTDSIAAAGa---pPELESFTFVGKTIYIKEGRCYDANDTIAGASITMM 314
gi 68248748  238 DVYTGIIVDGVHINYGNVRIDKKIKGDKLCIVTDSIAAAGa---pPELENFTFVGKTIYIKDGRCYDANGTIAGASITMM 314
gi 148825592 238 DVYTGIIVDGVHINYGNVRIDKKIKGDKLCIVTDSIAAAGa---pPELESFTFEGKTIYIKEGRCYDVNGTIAGASITMM 314
gi 148827281 238 DVYTGIIVDGVHINYGNVRIDKKIKGDKLCIVTDSIAAAGa---pPELESFTFEGKTIYIKEGRCYDANGTIAGASITMM 314
gi 15602739  237 DIYTGIIVDGLHVDYGNIRLDKKVKGDKLCIVTDATAAAG-----ADIDSFVFVGKTVYVRDGKCYDSNGTLGGAAITMI 311
gi 113461169 238 DIYSGIIADGLHVSFENIKLDKKLKGDKLCIVTDATAAAG-----ANIESFQFVGKTIYVRDGKCYDANGTLGGAAVTMI 312
gi 170717757 238 DIYSGIIADGLHVSFENIKLDKKLKGDKLCIVTDATAAAG-----ANIESFQFVGKTIYVRDGKCYDANGTLGGAAVTMI 312
gi 251792325 238 DVYTGIIVDGVHVNFGNVRVDKKIKGDKLCIVTDSLAAAGa---gSELESFTFVGKTIYVKDGRCYDGNGTIAGASITMM 314
gi 261868240 238 DVYTGIIVDGVHVNFGNVRLDKKVKGDKLCIVTDSLAAAGa---gPELESFTFVGKTIYVKDGRCYDGNGTIAGASITMM 314
                        330       340       350       360       370       380
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 290476162 320 ESVKNSVEYVGIALDETLRMVTLYPARAIGVDKRLGTIEPGKVANLTAFTHDFNICKTIVNGNEIELS 387
gi 16272107  315 ESIKNAVEYVEIPLAEAIRMSNLYPARAIGIDDRLGSVEKGKIANLAVFTPNYQVIGTVVNGKWKEN- 381
gi 68248748  315 ESIKNAVEYVEIPLAEAIRMSNLYPARAIGIDDRLGSVEKGKIANLAVFTPNYQVIGTVVNGKWKEN- 381
gi 148825592 315 ESIKNAVEYVEIPLAEAIRMSNLYPARAIGIDDRLGSVEKGKIANLAVFTPNYQVIGTVVNGKWKEN- 381
gi 148827281 315 ESIKNAVEYVEIPLAEAIRMSNLYPARAIGVDDRLGSVEKGKIANLAVFTPNYQVIGTVVNGKWKENE 382
gi 15602739  312 ESVKNAVQEVGIPLDETLRMCNYYPAKAIGVDHKLGSIEVGKIANLTAFTNDFNVLGTAVNGEWKAK- 378
gi 113461169 313 ESVENMVKYVEVPLDETLRMCNLYPARAIGVDDRLGSIEVGKIANLTVFDNQFNVIGTAVNGKWKTYC 380
gi 170717757 313 ESVENMVKYVEVPLDETLRMCNLYPARAIGVDDRLGSIEVGKIANLTVFDNQFNVIGTAVNGEWKTYC 380
gi 251792325 315 ESIKNAVEYVEIPLAEAVRMSNLYPARAIGVDDRLGSVEAGKIANLAVFTNDYKVIGTVVNGEWKVN- 381
gi 261868240 315 ESIKNAVEYVEIPLAEAVRMSNLYPARAIGVDDRLGSVETGKIANLAVFSNDYEVIGTVLNGEWKVN- 381
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap