Conserved Protein Domain Family
PRK10901

?
PRK10901: PRK10901 
16S rRNA methyltransferase B; Provisional
Statistics
?
PSSM-Id: 236790
View PSSM: PRK10901
Aligned: 271 rows
Threshold Bit Score: 488.16
Threshold Setting Gi: 171464329
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82701526    1 MIRTQRLAATTVERVV-SGASLTTVLQEtwrSHSGLS-DQQRGAIQDLSYGVLRFYGQLDILLGLLLNKPLKDQSLRYLL 78
gi 110670903   1 -MNTRAIAAKTILDILdNKYSLLTIGQK---LVKLNLlEQDKSFIKLLCYEFFRHYYSLEKIIALYLTQKTKVKAk-vLI 75
gi 134301576   1 -MNTRAIAAKTILDILdNKYSLLTIEQK---LVKLNLlEQDKSFIKLLCYEFFRHYYSLEKIIALYLTQKTKVKAk-vLI 75
gi 50086581   10 ELNLRAQVVATLLKVq-QGQSLSGILHQ---QLNDIP-ERDRALFHELVLGTLRQWYALKSITLPLLTKPLNNETVETCL 84
gi 299768269  10 RFNLRAQVVQTLLKVq-QGQSLASILNT---QLNQVA-ERDRALFHELVLGTLRQWFALKSISLPLLSKPLNNETVETCL 84
gi 126643464   1 ---------------------MASILNT---QLNQVA-ERDRALFHELVLGTLRQWFALKSISLPLLSKPLNNETVETCL 55
gi 184159973  10 RFNLRAQVVQTLLKVq-QGQSLASILNT---QLNQVA-ERDRALFHELVLGTLRQWFALKSISLPLLSKPLNNETVETCL 84
gi 213158779  10 RFNLRAQVVQTLLKVq-QGQSLASILNT---QLNQVA-ERDRALFHELVLGTLRQWFALKSISLPLLSKPLNNETVETCL 84
gi 169794225  10 RFNLRAQVVQTLLKVq-QGQSLASILNT---QLNQVA-ERDRALFHELVLGTLRQWFALKSISLPLLSKPLNNETVETCL 84
gi 215481783  10 RFNLRAQVVQTLLKVq-QGQSLASILNT---QLNQVA-ERDRALFHELVLGTLRQWFALKSISLPLLSKPLNNETVETCL 84
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82701526   79 LVGLYQLQYSKTAPHVVVDSAVSAScspsidgrnsRNMLDPrhakSIGGLVNAILRNFLRKRPALLEKTaatEVGRYSHP 158
gi 110670903  76 MLGALQIFEIKQPYYATINETVAAC----------KVLKII----WAKKLVNRILREMTRNIEYITSIYt--QNKAIDMP 139
gi 134301576  76 MLGALQIFEIKQPYYATINETVAAC----------KVLKII----WAKKLVNRILREMTRNIEYITSIYt--QNKAIDMP 139
gi 50086581   85 YLGLYQVLCTRIPAHAAISETVTAT----------KQLGFH----ALSGIVNAILRRATRETESFKNSL----QQAHGLP 146
gi 299768269  85 YVGLYQVLCTRIAAHAAISETVDAT----------KQLGFP----ALGGIVNAILRRATRETDDFQQGL----QQAHGLP 146
gi 126643464  56 YVGLYQVLCTRIAAHAAISETVDAT----------KQLGFP----ALSGIVNAILRRATRETEDFEQGL----QQAHGLP 117
gi 184159973  85 YVGLYQVLCTRIAAHAAISETVDAT----------KQLGFP----ALSGIVNAILRRATRETDDFQQGL----QQAHGLP 146
gi 213158779  85 YVGLYQVLCTRIAAHAAISETVDAT----------KQLGFP----ALSGIVNAILRRATRETEDFEQGL----HQAHGLP 146
gi 169794225  85 YVGLYQVLCTRIAAHAAISETVDAT----------KQLGFP----ALSGIVNAILRRATRETEDFEQGL----HQAHGLP 146
gi 215481783  85 YVGLYQVLCTRIAAHAAISETVDAT----------KQLGFP----ALSGIVNAILRRATRETEDFEQGL----HQAHGLP 146
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82701526  159 QWWIDKLRAQYPSRYQAVLETANIRPPMALRVNQRRTNVEAYQKLLHNAGLNArrPENE--WtEEALELFHPVPVEKLPG 236
gi 110670903 140 EWLCDTLKKQYPNDHLVIAQAINAKADMFIRLNQNKDNKK----VLDYFDKNN--IGYSftNlKDCIKLDQAIDVKYNQL 213
gi 134301576 140 EWLCDTLKKQYPNDHLVIAQAINAKADMFIRLNQNKDNKK----VLDYFDKNN--IGYSftNlKDCIKLDQAIDVKYNQL 213
gi 50086581  147 SWMYKRLKKDWPAQLNELCQQLKYSAPLTLRINQRHIGRDAYLIKLEAQDIQA--RACH--IsEAGIVIEQSVQITQLPG 222
gi 299768269 147 SWLFKRLKKDWGEQTESLCQSLKQVAPLTLRVNQRHIGRDAYLAKLQSLDIQA--RACT--LsEAGIVLEQSVQITQLPG 222
gi 126643464 118 SWLFKRLKKDWGEQTEALCQSLKQVAPLTLRVNQRHIGRDAYLAKLQSLDIQA--RACL--FsEAGIVLEQSVQITQLPG 193
gi 184159973 147 SWLFKRLKKDWGEQTEALCQSLKQAAPLTLRVNQRHIGRDAYLAKLQSLDIQS--RACL--FsEAGIVLEQSVQITQLPG 222
gi 213158779 147 SWLFKRLKKDWGEQTEALCQSLKQVAPLTLRVNQRHIGRDAYLAKLQSLDIQA--RACL--FsEAAIVLEQSVQITQLPG 222
gi 169794225 147 SWLFKRLKKDWGEQTEALCQSLKQVAPLTLRVNQRHIGRDAYLAKLQSLDIQA--RACL--FsEAAIVLEQSVQITQLPG 222
gi 215481783 147 SWLFKRLKKDWGEQTEALCQSLKQVAPLTLRVNQRHIGRDAYLAKLQSLDIQA--RACL--FsEAAIVLEQSVQITQLPG 222
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82701526  237 FGQGLVSVQDVAAQMAAPLLCPQSGMRVLDACAAPGGKSAHLLELTD-LELTAVDNDGERLERLKQNFTRLGLKpYR--- 312
gi 110670903 214 FQQGYFTIQDISAQYAGHIIKAANNDKILDACAAPGGKTSHILECAPqADITAIDIIDKRLELLRENLERLSEN-HN--- 289
gi 134301576 214 FQQGYFTIQDISAQYAGHIIRAANNDKILDACAAPGGKTSHILECAPqADITAIDIIDKRLELLRENLERLSEN-HN--- 289
gi 50086581  223 FEQGWFSVQDEHAQLCATLLPDLTDRVILDACAAPGGKTAHLLEKFTpAHLIALDQDASRLVRVSENLKRLKLD-QHhle 301
gi 299768269 223 FEEGWFSVQDEHAQLCVILLPDLNNKTVIDACAAPGGKTAHLLEKFKpAQLIAIDQDSNRLIRVTENLNRLALD-QSqte 301
gi 126643464 194 FEQGWFSVQDEHAQLCATLLPDLNNKTVIDACAAPGGKTAHLLEKFKpAQLIAIDQDPSRLVRVTENLNRLALD-QShte 272
gi 184159973 223 FEQGWFSVQDEHAQLCATLLPDLNNKTVIDACAAPGGKMAHLLEKFKpAQLIAIDQDPSRLVRVIENLNRLALD-QShte 301
gi 213158779 223 FEQGWFSVQDEHAQLCATLLPDLNNKTVIDACAAPGGKTAHLLEKFKpAQLIAIDQDPSRLVRVTENLNRLALD-QShte 301
gi 169794225 223 FEQGWFSVQDEHAQLCATLLPDLNNKTVIDACAAPGGKTAHLLEKFKpAQLIAIDQDPSRLVRVTENLNRLALD-QShte 301
gi 215481783 223 FEQGWFSVQDEHAQLCATLLPDLNNKTVIDACAAPGGKTAHLLEKFKpAQLIAIDQDPSRLVRVTENLNRLALD-QShte 301
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82701526  313 IIHGDATHPGEWWDGRPFDRILADAPCSASGVVRRHPDIKWLRRESDLAQFAEIQRKTLDALW-QTLVKGGKLLYVTCSI 391
gi 110670903 290 VNVFKHDLTLPL--AGKFNKIILDAPCSALGTIRRNPDIKVLRTPNDIQAIKSLQSKILANLWnNNLTDNGYLLYITCSI 367
gi 134301576 290 VNVFKHDLTLPL--AGKFNKIILDAPCSALGTIRRNPDIKVLRTPNDIQAIKSLQSKILANLWnNNLTDNGYLLYITCSI 367
gi 50086581  302 ILAADA---TTWQSSQALDCIVLDAPCSATGVMRRHPDIRLLRQSTDIVQTVDLQKQILQHLW-TQLKVGGTLLYITCSI 377
gi 299768269 302 ILAADA---TQWVPAEPVDCIVLDAPCSATGVIRRHPDIRLLRQSSDIAQTIELQKQILEHMW-QQLNVGGTLLYITCSV 377
gi 126643464 273 ILAADA---TKWNPVQPVDCIVLDAPCSATGVIRRHPDIRLLRQSSDIAQTIELQKQILEHMW-QQLKVGGTLLYITCSI 348
gi 184159973 302 ILAADA---TKWNPVQPVDCIVLDAPCSATGVIRRHPDIRLLRQSSDIAQTIELQKQILEHMW-QQLKVGGTLLYITCSI 377
gi 213158779 302 ILAADA---TKWNPVQPVDCIVLDAPCSATGVIRRHPDIRLLRQSSDIAQTIELQKQILEHMW-QQLKVGGTLLYITCSI 377
gi 169794225 302 ILAADA---TKWNPVQPVDCIVLDAPCSATGVIRRHPDIRLLRQSSDIAQTIELQKQILEHMW-QQLKVGGTLLYITCSI 377
gi 215481783 302 ILAADA---TKWNPVQPVDCIVLDAPCSATGVIRRHPDIRLLRQSSDIAQTIELQKQILEHMW-QQLKVGGTLLYITCSI 377
                        410       420       430       440       450       460
                 ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 82701526  392 FAEENGLQVESFLNHHPDARLLP----FSV-----PEIVEGQLLP-DLHHDGFFYALLEKL 442
gi 110670903 368 LAEENQQQIKEFLAKNNNAEIIE-----IDilekyKTSYGYQLLPsQQDGDGFYYCLLKKN 423
gi 134301576 368 LAEENQQQIKEFLAKNNNAEIIE-----IDilekyKTSYGYQLLPsQQDGDGFYYCLLKKN 423
gi 50086581  378 LKIENEQQMIEFFAEHPDAKEIKieadWGI-----EQIHGRQLLPvSGQGDGFYYCRIEKV 433
gi 299768269 378 LKAENEQQMINFFAEHSDAKEIKieanWGL-----EQIHGRQLLPqAQSGDGFYYCKIQKI 433
gi 126643464 349 LKSENEQQMINFFTEHPDAKEVKieadWGI-----EQVHGRQLLPeAQSGDGFYYCKIQKI 404
gi 184159973 378 LKSENEQQMINFFTEHPDAKEVKieadWGI-----EQVHGRQLLPeAQSGDGFYYCKIQKI 433
gi 213158779 378 LKSENEQQMINFFTEHTDAKEVKieadWGI-----EQTYGRQLLPeAQSGDGFYYCKIQKI 433
gi 169794225 378 LKSENEQQMINFFTEHPDAKEVKieadWGI-----EQVHGRQLLPeAQSGDGFYYCKIQKI 433
gi 215481783 378 LKSENEQQMINFFTEHPDAKEVKieadWGI-----EQVHGRQLLPeAQSGDGFYYCKIQKI 433
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap