Conserved Protein Domain Family
PRK10880

?
PRK10880: PRK10880 
adenine DNA glycosylase; Provisional
Statistics
?
PSSM-Id: 182805
View PSSM: PRK10880
Aligned: 98 rows
Threshold Bit Score: 709.17
Threshold Setting Gi: 238897586
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 261822646   2 MQAQQFAHQVLDWYQRYGRKTLPWQLEKTPYKVWLSEVMLQQTQVTTVIPYFQRFMARFPNVNALAAAPLDEVLHLWTGL 81
gi 197284227   2 MDAQQFSQVVLDWYHKYGRKTLPWQQEKTPYHVWLSEVMLQQTQVATVIPYFERFIARFPNVSALAKAPLDEVLHLWTGL 81
gi 300723984   2 MEAEQFSQVVLEWYHRYGRKTLPWQLEKTSYHVWLSEVMLQQTQVATVIPYFQKFISRFPDVASLATAPLDEVLHLWTGL 81
gi 290476330   2 MEAEQFSQAVLEWYHRYGRKTLPWQLEKTSYHVWLSEVMLQQTQVATVIPYFQNFISRFPNVASLAAAPLDEVLHLWTGL 81
gi 269137623   2 MQAQQFAHAVLAWYARFGRKTLPWQHPKTPYRVWLSEVMLQQTQVATVLPYFQRFTQRFPDVQALAAAPLDEVLHLWTGL 81
gi 238918235   2 MQAQQFAHAVLAWYARFGRKTLPWQHPKTPYRVWLSEVMLQQTQVATVLPYFQRFTQRFPDVQTLASAPLDEVLHLWTGL 81
gi 253990765   2 IEAKQFSKVVLDWYHLYGRKTLPWQLEKTSYHVWLSEVMLQQTQVATVIPYFQRFISRFPDVVSLAAAPLDEVLHLWTGL 81
gi 242240441   2 MQAQQFAQQVLEWYERCGRKTLPWQIEKTPYKVWLSEVMLQQTQVATVIPYFLRFMARFPTVSDLAAAPLDEVLHLWTGL 81
gi 271499453  18 MQAQQFAQQVLEWYERYGRKTLPWQLEKTPYKVWLSEVMLQQTQVTTVIPYFERFMARFPTVRELAAAPLDDVLHLWTGL 97
gi 251790786   2 MQAQQFAQQVLEWYERYGRKTLPWQLEKTPYKVWLSEVMLQQTQVATVIPYFERFMARFPTVSELAAAPLDDVLHLWTGL 81
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 261822646  82 GYYARARNLHKAAQTIVSRHGGDFPTTFDEVAALPGVGRSTAGAVLSLSLGQHFPILDGNVKRVLARCYAVDGWPGKKEV 161
gi 197284227  82 GYYARARNLHKAAQHIVDKHQGQFPDTFEDVCALPGVGRSTAGAILSLSLKKPYPILDGNVKRVLARCYAVEGWPGKKEV 161
gi 300723984  82 GYYARARNLHKAAQQIVTLHNGKFPTTFDDVVALPGVGRSTAGAILSLSQGKHFPILDGNVKRVLARCYAVAGWPGKKEV 161
gi 290476330  82 GYYARARNLHKAAQQIVAIHNGQFPTTFSDVIALPGVGRSTAGAILSLSQGKHFPILDGNVKRVLARCYAIAGWPGKKEV 161
gi 269137623  82 GYYARARNLHKAAQLIVSQHHGEFPQDFEQVAALPGIGRSTAGAILSLSLGQHHPILDGNVKRVLARCYAIPGWPGRKEV 161
gi 238918235  82 GYYARARNLHKAAQLIVSRHHGEFPHDFEQVAALPGIGRSTAGAILSLSLGQHHPILDGNVKRVLARCYAVPGWPGRKDV 161
gi 253990765  82 GYYARARNLHKAAQQIAERYHGEFPTTFDDVVALPGVGRSTAGAILSLSQGKHFPILDGNVKRVLARCYAMEGWPGKKEV 161
gi 242240441  82 GYYARARNLHKAAGIIVERHDGEFPTHFEEIAALPGVGRSTAGAVLSLALEQHYPILDGNVKRVLARCYAVAGWPGKKEV 161
gi 271499453  98 GYYARARNLHKAAQTIVERHGGDFPTRFDDIVDLPGVGRSTAGAILSLSLGQHYPILDGNVKRVLARCYAVTGWPGKKEV 177
gi 251790786  82 GYYARARNLHKAAQTIVNRHGGDFPTRFDDIVDLPGVGRSTAGAILSLSLGQHYPILDGNVKRVLARCYAVAGWPGKKEV 161
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 261822646 162 EKKLWARSEDVTPAEGVSQFNQAMMDLGAMVCTRSRPKCELCPLNTGCIAYANHSWAQYPGKKPKQTLPEKTGWFLLMQQ 241
gi 197284227 162 ENKLWEISEQVTPTKGVEYFNQAMMDLGAMVCTRTKPKCELCPLNTGCIAYAHHSWADYPGKKPKKAIPEKTTYFLILQY 241
gi 300723984 162 ENQLWDISTRVTPGQGVEYFNQAMMDLGAMVCTRSKPKCEICPLNTGCIAYANHSWADYPGKKPKQSIPERTAYFLLMQH 241
gi 290476330 162 ENQLWDISTRVTPKQGVEYFNQAMMDLGAMVCTRSKPKCEICPLNTGCISYANHSWASYPGKKPKQIIPEKTAYFLLMQY 241
gi 269137623 162 ETRLWQLSGEVTPADGVSQFNQAMMDLGALVCTRSRPKCELCPLNAGCLAYADGSWADFPGKKPKQTLPERQAYLLLLQH 241
gi 238918235 162 ETRLWQLSGEVTPADGVSQFNQAMMDLGALVCTRSRPKCELCPLNAGCLAYADGNWADFPGKKPRQTLPERQAYLLLLQH 241
gi 253990765 162 ENSLWQISTNVTPAKEVEYFNQAMMDLGAMVCTRSKPKCEICPLNQGCIAYANHSWTKYPGKKPKQSIPEKTAYFLLMQN 241
gi 242240441 162 EQRLWSLSESVTPAQGVEKFNQAMMDLGAMVCTRSRPKCELCPLSNGCLAYGNQSWAHYPGKKPKQILPEKTAWFLLAQQ 241
gi 271499453 178 EKQLWTLSETVTPALGVEKFNQAMMDLGAMVCTRSRPKCELCPLSNGCVAYANHNWAEYPGKKPKQTLPERNAWFLLMQQ 257
gi 251790786 162 EKQLWALSETVTPARGVEKFNQAMMDLGAMVCTRSRPKCELCPLSNGCIAYANHNWAEYPGKKPKQTLPERDAWFLLLQN 241
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 261822646 242 DSQVWLQQRPTVGLWGGLFCFPQFSERQELELWLQQRGLNPDGLQQLVAFRHTFSHFHLDIVPLWLNVSQDDrsqnrSCM 321
gi 197284227 242 DNLVWLDKRPPAGIWGGLFSFPQFETKMLLEQWLAEHGLENNKTEQLISFRHTFSHFHLDIVPICVKLSTFT-----SLM 316
gi 300723984 242 GNTVWLEQRPLSGIWGGLFAFPQFADQASLEQWLQDIGVSHSKPEQLTAFRHTFSHFHLDIVPIKIDILSFD-----SCM 316
gi 290476330 242 GDTVWLEQRPLSGIWGGLFAFPQFTDQTSLEQWLKDSGISHSKPDQLIAFRHTFSHFHLDIVPIKIDILSFD-----SCM 316
gi 269137623 242 GETVWLQQRPASGLWGGLFCFPQYDSEAALRAQLYRLGQDPDAAQTLTAFRHTFSHFHLDIIPVWSAYTTAS-----ACM 316
gi 238918235 242 GETVWLQQRPASGLWGGLFCFPQYDSEAALHTRLRHLGQDPTAAQTLTAFRHTFSHFHLDIIPVWSTYTTAS-----ACM 316
gi 253990765 242 NDSVWLEQRPPTGIWGGLFAFPQFESIDSLNDWLEQSGISHSKHEQLTAFRHTFSHFHLDIVPIKINILSFA-----ACM 316
gi 242240441 242 GQTVWLEQRPAVGLWGGLFCFPQFSVKEELEQWLEQRRLNVSGLRQGIAFRHTFSHFHLDIVPMWLNIADSG-----CCM 316
gi 271499453 258 AQTVWLEQRPAVGLWGGLYCFPQFTTKDELVQWLSQRGIPPQGLRQGIAFRHTFSHFHLDIVPMWLEVSDTG-----SCM 332
gi 251790786 242 EQTVWLEQRPAVGLWGGLYCFPQFATKDELTQWLEQRGIRRQGLRQGIAFRHTFSHFHLDIVPMWLDISDNG-----SCM 316
                        330       340       350
                 ....*....|....*....|....*....|....*
gi 261822646 322 DDGAGLWYNLAQPPSVGLAAPVERLLRELAHPQST 356
gi 197284227 317 EAQQGLWYNLQTPASVGLAAPVENLLRQLA----- 346
gi 300723984 317 DESKGLWYNLRQPATIGLAAPVEYLLQQLG----- 346
gi 290476330 317 DESKGLWYNLRQPATIGLAAPVEYLLQQLG----- 346
gi 269137623 317 DEGDGLWYNLAQPPSVGLAAPTERLLQQLRKQPPA 351
gi 238918235 317 DEGDGLWYNLAQPPSVGLAAPTERLLQQLRRQPPA 351
gi 253990765 317 DENKGLWYNLQQPATVGLAAPVEYLLQQLS----- 346
gi 242240441 317 DEGTGLWYNLAHPPSVGLAAPVERLLRQLAQPQSL 351
gi 271499453 333 DEGAGLWYNLAHPPSVGLAAPVERLLRQLAQPQSV 367
gi 251790786 317 DEGAGLWYNLAHPPSVGLAAPVERLLRQLAQPQSV 351
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap