Conserved Protein Domain Family
PRK10841

?
PRK10841: PRK10841 
hybrid sensory kinase in two-component regulatory system with RcsB and YojN; Provisional
Statistics
?
PSSM-Id: 182772
View PSSM: PRK10841
Aligned: 97 rows
Threshold Bit Score: 1530.68
Threshold Setting Gi: 260598667
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 300723733   1 MLWALGALLTSFYLANFFNETKSDIRQEYNANYDLAFTFMRSITNLLRDIQYITEKHLSQrtEKDLA---IIPPQYDNNT 77
gi 290473792   1 MLWVLGALLTSFYLVNIFNEVKSDIRQEYNTNYDTMFSYIRHTTNTLRDIQYMTEKHLSQknEKDLT-------ITLPYN 73
gi 51595601   32 MLWSLGALLTTFYILNVLNEKKADIRQEYNNNFGLAQNYIRHSAEIIRDIKYMAENRLDKnaSDTDA---TSGMVMNKKA 108
gi 153948861  24 MLWSLGALLTTFYILNVLNEKKADIRQEYNNNFGLAQNYIRHSAEIIRDIKYMAENRLDKnaSDTDA---TSGMVMNKKA 100
gi 170025068  32 MLWSLGALLTTFYILNVLNEKKADIRQEYNNNFGLAQNYIRHSAEIIRDIKYMAENRLDKnaSDTDA---TSGMVMNKKA 108
gi 186894665  32 MLWSLGALLTTFYILNVLNEKKADIRQEYNNNFGLAQNYIRHSAEIIRDIKYMAENRLDKnaSDTDA---TSGMVMNKKA 108
gi 269139680  24 MLWILGALLTTFYILNKFHEKESDIRQDFNLNFDQAQAVIRHANATMRDIRYIAENRLAWsgSDSSIqpySGRALDISGE 103
gi 238920517  52 MLWILGALLTTFYILNKFHEKESDIRQDFNLNFDQAQSIIRHANATMRDIRYIAENRLAWsgSEGSIppySGRALDISGE 131
gi 253989039  24 MLWTLGALLTAFYLVNIFNEVKSDIRQEYNANYDSTLSYVRHTASVLRDIQYMTEKHLLNsdEKKSV------VFDFPHN 97
gi 37526937   24 MLWALGALLTAFYLVNIFNEVKSDIRQEYNANYDSTLSYVRHTASVLRDIQYMTEKHLLN--SNGKN---AIFDFPHNNP 98
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 300723733  78 V-SY--TSLSTNSDCDLLHNKSHNYLGQLNNLITFWTQNISALYGANEIFFIEAQSMCMVNLSAHSRIIMSDPLRKTLYE 154
gi 290473792  74 NpAFsyTPLNMNSDCDLLRKSTHSYLDSLNNLILFWKDNIAAPRGLNQIFLVGTQSMCMVSFSVRSTITEPETLKKMVYE 153
gi 51595601  109 VpQY--YPLNSDSGCTTASTSNQASVNTLSNLIWYWKENFTAAYDLNRVFFIGTDTLCMVDFDIRNAPSLQENLLKSLYE 186
gi 153948861 101 VpQY--YPLNSDSGCTTASTSNQASVNTLSNLIWYWKENFTAAYDLNRVFFIGTDTLCMVDFDIRNAPSLQENLLKSLYE 178
gi 170025068 109 VpQY--YPLNSDSGCTTASTSNQASVNTLSNLIWYWKENFTAAYDLNRVFFIGTDTLCMVDFDIRNAPSLQENLLKSLYE 186
gi 186894665 109 VpQY--YPLNSDSGCTTASTSNQASVNTLSNLIWYWKENFTAAYDLNRVFFIGTDTLCMVDFDIRNAPSLQENLLKSLYE 186
gi 269139680 104 LpPL--LPIFPESDCRRISEGYRTSLRALSGFIRYWKENFVAAYDLNRIFVIGGSSQCLADFSIRNVPLDGGNTLRLLQQ 181
gi 238920517 132 LpPL--LPIFPESDCRRISAGYRTSLQALSGFIRYWKENFVAAYDLNRIFVIGGSSQCLADFSIRNVPLDGGNTLRLLQQ 209
gi 253989039  98 NpAFsyHPLNQSADCNTFRKNTHSYLNSLNNLIFYWKDNLAAPQGLNQVFLVGTQSMCMVNFSIRNTTTEPDTLKKIVYE 177
gi 37526937   99 AfSY--HPLNQNADCHTFRNNTHSYLNSLNNLIFYWKDNLAAPQGLNQVFLVGTQSMCMVSFSIRNTTTEPDTLKKIVYE 176
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 300723733 155 NARKLIIQKDQAKEQTIFWVMPYSRIDNGNLYVVTPVYANGQIAGVVGFEKSIKLKLFLQKREIPITITILNNTGKIELQ 234
gi 290473792 154 NFRKLIILKEQGKERNVFWVMPNTRADSGTFYILAPIYTNGQMTAVIGIEQAIRLDSFLPTRNRPISITMLNHYNQPELY 233
gi 51595601  187 HTLKYRDTKNQDKDSNIYWVVPGARPDIGVLYVLSPVYLGNRLEAMIGFEQSVRLEDFISSRTLPIRVTLLNQDNEPVLQ 266
gi 153948861 179 HTLKYRDTKNQDKDSNIYWVVPGARPDIGVLYVLSPVYLGNRLEAMIGFEQSVRLEDFISSRTLPIRVTLLNQDNEPVLQ 258
gi 170025068 187 HTLKYRDTKNQDKDSNIYWVVPGARPDIGVLYVLSPVYLGNRLEAMIGFEQSVRLEDFISSRTLPIRVTLLNQDNEPVLQ 266
gi 186894665 187 HTLKYRDTKNQDKDSNIYWVVPGARPDIGVLYVLSPVYLGNRLEAMIGFEQSVRLEDFISSRTLPIRVTLLNQNNEPVLQ 266
gi 269139680 182 RVMRFQGS--NDKDQSLFWVIPGAQSDAGSLYIASPIYSGNQLEAVLGTEQTLRLEELTNPSMLPIGVTLLSDSGDTLLS 259
gi 238920517 210 RMMRFQGS--NDKDPSLFWVIPGAQGDAGSLYIASPIYSGNQLEAVLGTEQTLRLEELTNPSMLPIGVTLLSDSGDTLLS 287
gi 253989039 178 NSRRLISLKEQGKERNVYWVIPGARSDSGHLYVLAPVYVNSQMVAMIGIEQFIRLDTFIQRQDRPISITLLNRSNQPVLH 257
gi 37526937  177 NSRRLISLKEQGKERNVYWVIPGARSDSGHLYVLAPVYVNGQMVAMIGIEQFIRLDSFIQRQDRPISITLLNSSNHPVLH 256
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 300723733 235 YPTQISDNNQPaIKFNIMSSNFGYDENFTSLILTRRLSPSTLHIAYTLPLKYIYDELKIKMINSIILNGISAILIAFFIW 314
gi 290473792 234 YPVKNDNKFRY-ADYNIQTPYFGYDEGFSNLLLKRRLAPSSFNVVFSLPLKYIYSELKVTIINSIVLNLIFTILIIFFVW 312
gi 51595601  267 MASGDRYPAIL-DDYPDSPSYFGYADDYKDLILKKALPPSPLSIAYSLPVKTIIEAFKLLIFNALLLNVLSAVVIFTLAW 345
gi 153948861 259 MASGDRYPAIL-DDYPDSPSYFGYADDYKDLILKKTLPPSPLSIAYSLPVKTIIEAFKLLIFNALLLNVLSAVVIFTLAW 337
gi 170025068 267 MASGDRYPAIL-DDYPDSPSYFGYADDYKDLILKKTLPPSPLSIAYSLPVKTIIEAFKLLIFNALLLNVLSAVVIFTLAW 345
gi 186894665 267 MASGDRYPAIL-DDYPDSPSYFGYADDYKDLILKKALPPSPLSIAYSLPVKTIIEAFKLLIFNALLLNVLSAVVIFTLAW 345
gi 269139680 260 YAENGGPLPIL-SGLPDDENYFGYNSSYDTLLLKKKLQPSGLSIVYSLPSRVLLERFNLLLINAIVLNLISGIVLFVLTW 338
gi 238920517 288 YAENGGPLPIL-SGLPDDENYFGYNSGYDTLLLKKKLQPSDLSIVYSLPSRVLLERFNLLLINAIVLNLISGIVLFVLTW 366
gi 253989039 258 YPANDDYKLHY-DDYQLEAPYFGYDDNFTDLLLKRRLMPSSFSIIYALPLKNIFEGFKLQIISSIVLNVLSAFVIIILVY 336
gi 37526937  257 YPANDDYKLHY-ADYQLEAPYFGYDDNFTDLLLKRRLMPSSFSIIYALSLKTIFEGFKLQIISSIVLNALSAFVIIILVY 335
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 300723733 315 LFERKMFAPAEDNAIRLEEHEQFNHKIVASAPVGISILRVSDGVSILSNELAHNYTQMLTYEDQKRIVDIICDKTSSYID 394
gi 290473792 313 LFERKIFSPAEENAIRLEEHEQFNHKIVASAPVGISILRINDGANILSNELAHNYTRMLTYEDQKRIVDIICDKTSSYID 392
gi 51595601  346 LFERKMFHPAEDNALRLEEHEQFNRKIVASAPVGISILRISDGTNILSNELAHNYISLLTNEDRERITRIICERQANFVD 425
gi 153948861 338 LFERKMFHPAEDNALRLEEHEQFNRKIVASAPVGISILRISDGTNILSNELAHNYISLLTNEDRERITRIICERQANFVD 417
gi 170025068 346 LFERKMFHPAEDNALRLEEHEQFNRKIVASAPVGISILRISDGTNILSNELAHNYISLLTNEDRERITRIICERQANFVD 425
gi 186894665 346 LFERKMFHPAEDNALRLEEHEQFNRKIVASAPVGISILRISDGTNILSNELAHNYISLLTNEDRERITRIICERQANFVD 425
gi 269139680 339 LFERKMFRPAENNALRLEEHEQFNRKIVASAPVGISILRTRDGSNILSNELAHNYISQFTPEDRQRITRIICEEPVSVLD 418
gi 238920517 367 LFERKMFLPAENNALRLEEHEQFNRKIVASAPVGISILRARDGSNILSNELAHNYISQFTPEDRQRITRIICEEPISVLD 446
gi 253989039 337 LFERKMFVPAEENAIRLEEHEQFNHKIVASAPVGISILRVSDGSNILSNELAHNYLKMLTHEDRERIIHIICDRTSSYVD 416
gi 37526937  336 LFERKMFVPAEENAIRLEEHEQFNHKIVASAPVGISILRVSDGSNILSNELAHNYLRMLTHEDRERIIHIICDRTSSYVD 415
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 300723733 395 VVTSNNNHLQISFVHSRYRNEEVAICVLIDVSTRVKMEKSLQEMATAAEQANQAKSMFLATVSHELRTPLYGIIGNLELI 474
gi 290473792 393 VVTSNNNHLQISFVHSRYRNEEVAICVLVDISTRVKMEQSLQEMASAAEQANQAKSMFLATVSHELRTPLYGIIGNLELL 472
gi 51595601  426 VMTSNNNNLQISFVHSRYRNEDVAICVLVDVSARVKMEESLQEMATAAEQASQSKSMFLATVSHELRTPLYGIIGNLDLL 505
gi 153948861 418 VMTSNNNNLQISFVHSRYRNEDVAICVLVDVSARVKMEESLQEMATAAEQASQSKSMFLATVSHELRTPLYGIIGNLDLL 497
gi 170025068 426 VMTSNNNNLQISFVHSRYRNEDVAICVLVDVSARVKMEESLQEMATAAEQASQSKSMFLATVSHELRTPLYGIIGNLDLL 505
gi 186894665 426 VMTSNNNNLQISFVHSRYRNEDVAICVLVDVSARVKMEESLQEMATAAEQASQSKSMFLATVSHELRTPLYGIIGNLDLL 505
gi 269139680 419 VITVQNQNLQISFVRSRYRNEDVAICAMVDVSARVKMEESLQEMAAAAEQASQSKSMFLATVSHELRTPLYGIIGNLDLL 498
gi 238920517 447 VITVQNQNLQISFVRSRYRNEDVAICAMVDVSARVKMEESLQEMAAAAEQASQSKSMFLATVSHELRTPLYGIIGNLDLL 526
gi 253989039 417 VVTSNNNHLQISFVHSRYRNEEVAICVLVDISARVRMEKSLQEMALASEQASYSKSMFLATVSHELRTPLYGIIGNLELL 496
gi 37526937  416 VVTSNHHHLQISFVHSRYRNEEVAICVLVDISVRVRMEKSLQEMALASEQANYSKSMFLATVSHELRTPLYGIIGNLELL 495
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 300723733 475 QSHLLPPESTRLLATMNNSSSLLLKIISDILDFSKIESKQLKIEPKDFSCKEVISHVISNYLPLIAKKALGLYCYIEPNV 554
gi 290473792 473 QSHTLPSESARLLSAMNNASSLLLKIISDILDFSKIESKQLKIDSKKFSCKEIVLHVISNYLPLIVKKELGLYCYIEPDI 552
gi 51595601  506 QTKELPQGVDRLVTAMNNSSGLLLKIISDILDFSKIESEQLKIEPSEFSTVEVITHITANYLPLVVKKRLGLYCFIEPDV 585
gi 153948861 498 QTKELPQGVDRLVTAMNNSSGLLLKIISDILDFSKIESEQLKIEPSEFSTVEVITHITANYLPLVVKKRLGLYCFIEPDV 577
gi 170025068 506 QTKELPQGVDRLVTAMNNSSGLLLKIISDILDFSKIESEQLKIEPSEFSTVEVITHITANYLPLVVKKRLGLYCFIEPDV 585
gi 186894665 506 QTKELPQGVDRLVTAMNNSSGLLLKIISDILDFSKIESEQLKIEPSEFSTVEVITHITANYLPLVVKKRLGLYCFIEPDV 585
gi 269139680 499 RTKTLPEEVQRLLGAMSNSSGLLLKIINDILDFSKIESEQLKIEPGRFVPREVIPHIIGNYLPLVVRKRLTLYCFIEPDV 578
gi 238920517 527 RTKTLPEEVQRLLGAMSNSSGLLLKIINDILDFSKIESEQLKIEPGRFVPREVIPHIIGNYLPLVVRKRLTLYCFIEPEV 606
gi 253989039 497 QAHSLPAESARLLSTMNNSSALLLKIISDILDFSKIESKQLKIEPKEFSCQEVISHVISNYLPLVVKKSLSLYCYIEPDV 576
gi 37526937  496 QAHSLPAESVRLLSTMNNSSALLLKIISDILDFSKIESKQLKIESREFSCQEVISHVISNYLPLVVKKPLTLYCYIEPGV 575
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 300723733 555 PNIIRNDPVRLQQIISNLLNNAIKFTASGCVVIEIVSKHGYLYFSIKDTGLGIEDKLQFQLFEPFFQISANKESSPQGTG 634
gi 290473792 553 PDIINNDPVRLQQIISNLLNNAIKFTETGSVVITISIKHSYLYISIKDTGVGIEDKLQTQLFEPFFQINANKQTFSQGTG 632
gi 51595601  586 PRLIEGDPVRLQQVISNLLNNAIKFTDTGCIILQVRVRDCYLEFRVRDTGVGIDSREINQLFDPFFQVGTGVQRHFQGTG 665
gi 153948861 578 PRLIEGDPVRLQQVISNLLNNAIKFTDTGCIILQVRVRDCYLEFRVRDTGVGIDSREINQLFDPFFQVGTGVQRHFQGTG 657
gi 170025068 586 PRLIEGDPVRLQQVISNLLNNAIKFTDTGCIILQVRVRDCYLEFRVRDTGVGIDSREINQLFDPFFQVGTGVQRHFQGTG 665
gi 186894665 586 PRLIEGDPVRLQQVISNLLNNAIKFTDTGCIILQVRVRDCYLEFRVRDTGVGIDSREINQLFDPFFQVGTGVQRHFQGTG 665
gi 269139680 579 PEALSGDIMRIQQVLSNLLSNAIKFTDTGCIILQARVNDFYLEFRVRDTGLGIPPRDVLRLFDPFFQVGSGVQRHFHGTG 658
gi 238920517 607 PEALSGDIMRIQQVLSNLLSNAIKFTDTGCIILQARVNDFYLEFRVRDTGLGIPPRDVLRLFDPFFQVGSGVQRHFHGTG 686
gi 253989039 577 PNYIRNDPVRLQQVISNLLNNAIKFTDTGCVAIHVVVDKDYLYVRVRDTGVGISDKELIQLFDPFFQIMPNTESSSQGTG 656
gi 37526937  576 PDYICNDPVRLQQVISNLLNNAIKFTDTGCVIIHVTVDKDYLYVRIKDTGVGISDKALIQLFDPFFQIMPNTESSSQGTG 655
                        650       660       670       680       690       700       710       720
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 300723733 635 LGLAICEKLINLMDGDIEFISQKYVGSIFSIRIPLYGVKFHTKKISSQRNQKKILLTIYNDFMEKYLQAFLSQNHFQVTL 714
gi 290473792 633 LGLAICEKLINLMDGDIEFISQQYIGSIFSIRLPLYGAKYHTKAYSKNRTQQKIVLAVRNDYLEKYLQNFLTKNYFQIAL 712
gi 51595601  666 LGLAICEKLVNLMDGDVEVISELGMGSIFAIRIPLYHHQNTVLSANDRWQGKVLWLDIRNARLESYLLDLLGYFGATIRR 745
gi 153948861 658 LGLAICEKLVNLMDGDVEVISELGMGSIFAIRIPLYHHQNTVLSANDRWQGKVLWLDIRNARLESYLLDLLGYFGATIRR 737
gi 170025068 666 LGLAICEKLVNLMDGDVEVISELGMGSIFAIRIPLYHHQNTVLSANDRWQGKVLWLDIRNARLESYLLDLLGYFGATIRR 745
gi 186894665 666 LGLAICEKLVNLMDGDVEVISELGMGSIFAIRIPLYHHQNTVLSANDRWQGKVLWLDIRNARLESYLLDLLGYFGATIRR 745
gi 269139680 659 LGLAICEKLVSLMDGDIAVESSPGLGSIFTIRLPMYQA-KAAQPLQPALQQRTLWLDIHNARLERYLQTLLSAAGARVCL 737
gi 238920517 687 LGLAICEKLVSLMDGDIAVESSPGLGSIFTIRLPMY-QARAAQPLQPILQQRTLWLDIHNARLERYLQTLLSAAGARVCL 765
gi 253989039 657 LGLAICEKLINLMDGDIEVISQPQIGSMFSIRLPLYGAKYTPKTQLTNEYQQKVILAIRNLYLEDFLQRFLIYHGLQVVV 736
gi 37526937  656 LGLAICEKLINLMDGDIEVISQPQIGSMFSIRLPLYGAKYRPKTQLINESQRKIILAIRNLYLEEFLQRFLVHHGLHTVL 735
                        730       740       750       760       770       780       790       800
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 300723733 715 YN-GEEIDGTEILISDQPNNIDIPVHGYIEISEKHIGPPKQIRKNYWLYNTYELSELDNMLDNLLTTDNLISISAVSTSS 793
gi 290473792 713 YD-KSKIDGTELVILDQPDVLDIAVRYYIEISEKHIGPPKQIREHYWLHNTYQLIELDSVIDKLLSKNNHISPATISMST 791
gi 51595601  746 YC-GEQTQPEDVLICDYPSQLSPPLLAWIQLSIEHIGLPQETRPAYWSLSTSTLLEIVPLLDWILRGQQPVDNSSLQLHA 824
gi 153948861 738 YC-GEQTQPEDVLICDYPSQLSPPLLAWIQLSIEHIGLPQETRPAYWSLSTSTLLEIVPLLDWILRGQQPVDNSSLQLHA 816
gi 170025068 746 YC-GEQTQPEDVLICDYPSQLSPPLLAWIQLSIEHIGLPQETRPAYWSLSTSTLLEIVPLLDWILRGQQPVDNSSLQLHA 824
gi 186894665 746 YC-GEQTQPEDVLICDYPSQLSPPLLAWIQLSIEHIGLPQETRPAYWSLSTSTLLEIVPLLDWILRGQQPVDNSSLQLHA 824
gi 269139680 738 CPpLTPSTAQDVLICDHPPQTGQAFAAQVRLCADYLGHARRHASGEWLLNTAAPLELLQVLNRIFAPESVVECSPDSASA 817
gi 238920517 766 CPpIVPSTAQDVLICDHPPQTGLAFAARVRLCADYLGHACRRASGEWLLNTAAPLELLQVLNRIFAPESVAECSLESAIA 845
gi 253989039 737 YH-GQNTDGSEIIISDFSNAVITPIYAYVELSTSHIGSLEQIRENYWLHNTYHLHDLAILIDRLI-----SPGNSEVLNT 810
gi 37526937  736 YS-EQNTEGSEIIISDFPDAVISPVYAYIELSTDYIGSPEQIRENYWLHNTYHLHDLSVMIERLI-----SPNHHVVLNT 809
                        810       820       830       840       850       860       870       880
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 300723733 794 iTAKTIQVDhrlNTVKVLVVDDHPINRHLLVDQLNSIGF-NTSMANDGIEAIEYIKNNPTDIILTDVNMPNMDGYELTQY 872
gi 290473792 792 -SIRADSRL---STIKILVVDDHPLNRHLLIEQLNTIGF-RTASANDGIDAIEHLKNNSTDIILTDVNMPNMDGYELTKY 866
gi 51595601  825 -PKTNQDNN---ADLQILVVDDHPINRRLLADQLTTLGY-RVITANDGLDALVALNTNTVDMVLTDVNMPNMDGYRLTER 899
gi 153948861 817 -PKTNQDNN---ADLQILVVDDHPINRRLLADQLTTLGY-RVITANDGLDALVALNTNTVDMVLTDVNMPNMDGYRLTER 891
gi 170025068 825 -PKTNQDNN---ADLQILVVDDHPINRRLLADQLTTLGY-RVITANDGLDALVALNTNTVDMVLTDVNMPNMDGYRLTER 899
gi 186894665 825 -PKTNQDNN---ADLQILVVDDHPINRRLLADQLTTLGY-RVITANDGLDALVALNTNTVDMVLTDVNMPNMDGYRLTER 899
gi 269139680 818 aPADRQQDF---SDIAVLIVDDHPINRRLLADQLISLGFsQVAVACDGVDALGALQQQAADIVLTDVNMPNMDGYQLTER 894
gi 238920517 846 aPTDRQQDF---SDIALLIVDDHPINRRLLADQLISLGFsQVAVACDGVDALGALQQQAADIVLTDVNMPNMDGYQLTER 922
gi 253989039 811 -ALPVLQAStwlNTIMVLVVDDHPINRYLLTDQLKSIGF-QAAMANDGLDALEYLKKEYVDIILTDVNMPNMDGYALTMY 888
gi 37526937  810 -APPVFQANtrfNTIVVLVVDDHPINRRLLADQLKSIGF-QTAMANDGLDALEYLKSGGIDIILTDVNMPNMDGYALTMY 887
                        890       900       910       920       930
                 ....*....|....*....|....*....|....*....|....*....|....*...
gi 300723733 873 LRSKGYAKPIIGITANALAEEKERCTNVGMDSCLPKPVSLAILKNILIEHINIKGKTY 930
gi 290473792 867 LRDKGYTSPIIGITANALAEEKQRCADAGMDYCLSKPVSLATLRDTLIEYSDIQS--- 921
gi 51595601  900 LRQLNHNFPIIGVTANALAEGKQRCIEAGMDNCLSKPVTLDTLRQMLLYYSDQVRRSR 957
gi 153948861 892 LRQLNHNFPIIGVTANALAEGKQRCIEAGMDNCLSKPVTLDTLRQMLLYYSDQVRRSR 949
gi 170025068 900 LRQLNHNFPIIGVTANALAEGKQRCIEAGMDNCLSKPVTLDTLRQMLLYYSDQVRRSR 957
gi 186894665 900 LRQLNHNFPIIGVTANALAEGKQRCIEAGMDNCLSKPVTLDTLRQMLLYYSDQVRRSR 957
gi 269139680 895 LRQQGRTLPIVGVTANALAEERQRCIEVGMDSCLSKPVMREDLLASLSGYALQIRRRR 952
gi 238920517 923 LRQQGRTLPIVGVTANALAEERQRCIEVGMDSCLSKPVMREDLLASLSGYAQQIRRRR 980
gi 253989039 889 LRNKGCELPIIGITANALAEEKQRCIDAGMNDCLSKPVSLATLKQVLTEVGSMSA--- 943
gi 37526937  888 LRNDGCKLPIIGITANALAEEKQRCIDAGMDDCLSKPVSLVTLRQTLTQMI------- 938
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap