Conserved Protein Domain Family
PRK10776

?
PRK10776: PRK10776 
nucleoside triphosphate pyrophosphohydrolase; Provisional
Statistics
?
PSSM-Id: 182721
View PSSM: PRK10776
Aligned: 89 rows
Threshold Bit Score: 231.798
Threshold Setting Gi: 253689943
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157147477   1 MKKLQIAVGIIRNPNHEVFITQRAADAHMANKLEFPGGKIEAGETPEQALIRELQEEVGITPREATLFEKLEYQFPDRHI 80
gi 153947034   1 MKHLQIAVGIIRNSQQEIFITQRAADSHMAGFWEFPGGKIEQGETPEIALKRELLEETGIVVQQATLLTMLEHTFSDRIV 80
gi 170025723   1 MKHLQIAVGIIRNSQQEIFITQRAADSHMAGFWEFPGGKIEQGETPEIALKRELLEETGIVVQQATLLTMLEHTFSDRIV 80
gi 186894054   1 MKHLQIAVGIIRNSQQEIFITQRAADSHMAGFWEFPGGKIEQGETPEIALKRELLEETGIVVQQATLLTMLEHTFSDRIV 80
gi 85058436    1 MTIRTIAVGIIRNARREIFIARRPADVHMGGFWEFPGGKVEPGETPEQALYRELREETGIDVERAQLLATTQHAFAERQL 80
gi 261823006   3 QKQLSVAVGIIRNAEQQYFIARRPDGVHMAGMWEFPGGKIEAGETPEQGLIRELFEETGIDASAPQPLNNKTFSTPERII 82
gi 50122727    3 QKQLSVAVGIIRNTEQQYFIARRPDGVHMAGMWEFPGGKIEAGETPEQALIRELHEETGIEAIAPQPLNDKTFSTPERII 82
gi 253689943   3 QKQLSVAVGIIRNVEQQYFIARRPDGVHMAGMWEFPGGKIEEGETPEQALIRELREETGIDASAPQSLNDKTFSTPERII 82
gi 242238111   3 LKPLSVAVGIIRNLEHEFFIACRPEGVHMAGKWEFPGGKVEAGETPEQALVRELREETGIDVVNPQHLENKTFPAGERLI 82
gi 271502032  13 QKTLSVAVGIIRNPQREFFIACRPAGVHMAGKWEFPGGKVEEGETPEQALARELHEEAGIEVINPSPLGSKTFSAGERLI 92
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|....*....
gi 157147477  81 TLWFWLVDHWEGEPWGKEGQPGRWIAQDALNAEDFPPANAPVIEKLIAG 129
gi 153947034  81 TLHFYRVEVWDGEPFGREGQPMRWVLQSELRADEFPPANAAIIELLTK- 128
gi 170025723  81 TLHFYRVEVWDGEPFGREGQPMRWVLQSELRADEFPPANAAIIELLTK- 128
gi 186894054  81 TLHFYRVEVWDGEPFGREGQPMRWVLQSELRADEFPPANAAIIELLTK- 128
gi 85058436   81 AFYFYLVEQWRGTPCGNEGQPVRWCPQQALRADEFPPANAAIIRQLTAD 129
gi 261823006  83 TLHFFLVETWQGEPYGREGQESRWVSVEELREEEFPPANAEMIRWLKSF 131
gi 50122727   83 TLHFFLVETWQGEPYGREGQESRWVSVEALREDEFPPANAEVIRWLKSL 131
gi 253689943  83 TLHFFLVETWQGEPYGREGQESRWVSVEELREEEFPPANAEMIRWLKSL 131
gi 242238111  83 TLHFFLVEEWRGEPYGREGQRSRWLTVEQLDADEFPPANAEMIRWLKSN 131
gi 271502032  93 TLHFFLVEQWRGEPYGREGQPSRWLTAEELDEHEFPPANAEMIQQLKAG 141
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap