Conserved Protein Domain Family
PRK10762

?
PRK10762: PRK10762 
D-ribose transporter ATP binding protein; Provisional
Statistics
?
PSSM-Id: 236755
View PSSM: PRK10762
Aligned: 109 rows
Threshold Bit Score: 948.673
Threshold Setting Gi: 294139403
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 283787561   1 MDALLQLKGIDKSFPGVKALSGAALNVYAGRVMALVGENGAGKSTMMKVLTGIYTRDAGSLLWLGKETTFNGPKSSQEAG 80
gi 117620895   3 PSPILALSGIVKTFPGVRALDEAGLKVYPGQVMALLGENGAGKSTLMKVLTGIYQADAGNISYRGQPVHFKGPRDSQDQG 82
gi 147671783   2 TQAILALSQIEKAFPGVKALDKASLNVYPGRVMALMGENGAGKSTLMKVLTGIYSKDAGSIEYQGQPVSFKGPRDSQLAG 81
gi 227811754   2 TQAILALSQIEKAFPGVKALDKASLNVYPGRVMALMGENGAGKSTLMKVLTGIYSKDAGSIEYQGQPVSFKGPRDSQLAG 81
gi 156977359   2 AQAILQLSEIEKAFPGVKALDKASLNVYPGRVMALMGENGAGKSTLMKVLTGIYHMDAGSIKYQGQPAAFKGPRDSQEAG 81
gi 37676229    2 NQAILQLSEIEKAFPGVKALDKASLNVYPGRVMALMGENGAGKSTLMKVLTGIYSRDAGEIVYQGQPAQFKGPRDSQQAG 81
gi 27366521    2 NQAILQLSEIEKAFPGVKALDKASLNVYPGRVMALMGENGAGKSTLMKVLTGIYSRDAGEIVYQGQSAQFKGPRDSQQAG 81
gi 15600899    2 TQAILALSQIEKAFPGVKALDKASLNVYPGRVMALMGENGAGKSTLMKVLTGIYSKDAGSIEYQGQPVSFKGPRDSQLAG 81
gi 218676702   2 TQAILELSSIEKAFPGVKALDKASLNVYPGRVMALMGENGAGKSTLMKVLTGIYHLDGGAIAYQGKPAAFKGPRDSQQAG 81
gi 229605178   2 TQAILALSQIEKAFPGVKALDKASLNVYPGRVMALMGENGAGKSTLMKVLTGIYSKDAGSIEYQGQPVSFKGPRDSQLAG 81
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 283787561  81 IGIIHQELNLIPQLTIAENIFLGREFVNRFGKIDWKKMYAEADLLLAKLNLRFKSDRLLGDLSIGDQQMVEIAKVLSFES 160
gi 117620895  83 ISIIHQELNLLPELSIAANIFLGREPRTRFGSIDHKQLRERASGLLARLGVKHGPDTRLGDLSIGEQQMVEIAKALSFDA 162
gi 147671783  82 ISIIHQELNLIPQLTIAENIFLGREMTSPFGRILWDEMHRKADQLLARLNVKHSAKTLLGELSLGEQQMVEIAKALSFES 161
gi 227811754  82 ISIIHQELNLIPQLTIAENIFLGREMTSPFGRILWDEMHRKADQLLARLNVKHSAKTLLGELSLGEQQMVEIAKALSFES 161
gi 156977359  82 ISIIHQELNLIPELTIAENIYLGREFTGSMGRIQWGKMYEEADKLLQRLNVKHSSKTLLGDLSLGEQQMVEIAKALSFES 161
gi 37676229   82 ISIIHQELNLIRELTIAENIFLGREITSAFGRIDWPQMYAEADKLLARLKVKHSSKTLLGQLSLGEQQMVEIAKALSFES 161
gi 27366521   82 ISIIHQELNLIRELTIAENIFLGREITSAFGRIDWPQMYAEADKLLARLKVKHSSKTLLGQLSLGEQQMVEIAKALSFES 161
gi 15600899   82 ISIIHQELNLIPQLTIAENIFLGREMTSPFGRILWDEMHRKADQLLARLNVKHSAKTLLGELSLGEQQMVEIAKALSFES 161
gi 218676702  82 ISIIHQELNLIPELTIAENIFLGREITGTMGRILWNEMYQEADKLLKRLNVKHSSKTPLGQLSLGEQQMVEIAKALSFES 161
gi 229605178  82 ISIIHQELNLIPQLTIAENIFLGREMTSPFGRILWDEMHRKADQLLARLNVKHSAKTLLGELSLGEQQMVEIAKALSFES 161
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 283787561 161 KVIIMDEPTDALTDTETESLFRVIRELKSQGRGIVYISHRMKEIFEICDDVTVFRDGQFIAEREVASLTEDSLIEMMVGR 240
gi 117620895 163 SVIIMDEPTDALTDTETEQLFVVIRELREQGCGIVYISHRLKEIFEICDRVTVLRDGKWIGEQAVSELDEDRIIEMMVGR 242
gi 147671783 162 KVIIMDEPTDALTDTETESLFNVINELREQGCGIVYISHRLKEIFEICDDITVLRDGKFIGECRVCDTNEDGLIEMMVGR 241
gi 227811754 162 KVIIMDEPTDALTDTETESLFNVINELREQGCGIVYISHRLKEIFEICDDITVLRDGKFIGECRVCDTNEDGLIEMMVGR 241
gi 156977359 162 KVIIMDEPTDALTDKETESLFKVINELRGQGCGIVYISHRLKEIFEICDDITVLRDGKFIGECEVKDTNEDGLIEMMVGR 241
gi 37676229  162 KVIIMDEPTDALTDTETEALFSVIRELREQGCGIVYISHRLKEIFEICDDITVLRDGKFIGQCEVVQTDEDGLIEMMVGR 241
gi 27366521  162 KVIIMDEPTDALTDTETEALFSVIRELREQGCGIVYISHRLKEIFEICDDITVLRDGKFIGQCEVVQTDEDGLIEMMVGR 241
gi 15600899  162 KVIIMDEPTDALTDTETESLFNVINELREQGCGIVYISHRLKEIFEICDDITVLRDGKFIGECRVCDTNEDGLIEMMVGR 241
gi 218676702 162 KVIIMDEPTDALTDTETESLFKVINELRDEGCGIVYISHRLKEIFEICDDITVLRDGKFIGQCEVKDTDEDGLIEMMVGR 241
gi 229605178 162 KVIIMDEPTDALTDTETESLFNVINELREQGCGIVYISHRLKEIFEICDDITVLRDGKFIGECRVCDTNEDGLIEMMVGR 241
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 283787561 241 KLEDQYPRLDKAPGEVRLKVDNLCGPGVNHVSFTLRKGEILGVSGLMGAGRTELMKVLYGALPRTSGHVTLDGREVVTRS 320
gi 117620895 243 RLEEQYPRLARELGPVSLQVKDLAGPGVRGVSFSLRQGEILGFSGLMGSGRTELMKLIYGASPISAGDITVDGHALVPKS 322
gi 147671783 242 KLEEQYPRIAAQQGDISLEVIGLTGSGVHDVSFTLKKGEILGVSGLMGAGRTELMKVIYGALPSERGVINLNGRTVNPVS 321
gi 227811754 242 KLEEQYPRIAAQQGDISLEVIGLTGSGVHDVSFTLKKGEILGVSGLMGAGRTELMKVIYGALPSERGVINLNGRTVNPVS 321
gi 156977359 242 KLEEQYPRIDVKHGDVCLEVIGLTGSGVHDINFTLQRGEILGVSGLMGAGRTELMKVIYGALPSERGVINLDNKTINPVS 321
gi 37676229  242 KLEEQYPRIDVVHGQTCLEVIGLTGSGVHDVSFTLKRGEILGISGLMGAGRTELMKVIYGALPSERGVINLDNRTINPVS 321
gi 27366521  242 KLEEQYPRIDVVHGQTCLEVIGLTGSGVHDVSFTLKRGEILGISGLMGAGRTELMKVIYGALPSERGVINLDNRTINPIS 321
gi 15600899  242 KLEEQYPRIAAQQGDISLEVIGLTGSGVHDVSFTLKKGEILGVSGLMGAGRTELMKVIYGALPSERGVINLNGRTVNPVS 321
gi 218676702 242 KLDEQYPRIGQSHGETCLEVIGLTGSGVHDVSFTLKRGEILGVSGLMGAGRTELMKVIYGALPSERGVINLENKTINPVS 321
gi 229605178 242 KLEEQYPRIAAQQGDISLEVIGLTGSGVHDVSFTLKKGEILGVSGLMGAGRTELMKVIYGALPSERGVINLNGRTVNPVS 321
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 283787561 321 PQDGLANGIVYISEDRKRDGLVLGMSVKENMSLTALRYFSRaGGGLRHKDEQQAVSDFIRLFNVKTPSMEQAIGLLSGGN 400
gi 117620895 323 PADGLAAGIAYISEDRKGDGLVLELSVRENMSLCALGEFIS-HGKIDGQAERQAVGDYVRLFNIKTPSQDQLIKLLSGGN 401
gi 147671783 322 PQDGLANGIAYISEDRKGDGLVLGLSVKENMSLCALDQLSK-GVQIRHADEVIAVDDFIRLFNIKTPSREQIIGNLSGGN 400
gi 227811754 322 PQDGLANGIAYISEDRKGDGLVLGLSVKENMSLCALDQLSK-GVQIRHADEVIAVDDFIRLFNIKTPSREQIIGNLSGGN 400
gi 156977359 322 PQDGLANGIAYISEDRKGDGLVLGLSVKENMSLCALDKLTK-GFQIQHGEEVVAVEDFIKLFNIKTPTRDQIIGNLSGGN 400
gi 37676229  322 PQDGLANGIAYISEDRKGDGLVLGLSVKENMSLCALDKLSK-GVQIQHQDEVVAVDDFIQLFNIKTPSREQIIGNLSGGN 400
gi 27366521  322 PQDGLANGIAYISEDRKGDGLVLGLSVKENMSLCALDKLSK-GVQIQHQDEVVAVDDFIQLFNIKTPSREQIIGNLSGGN 400
gi 15600899  322 PQDGLANGIAYISEDRKGDGLVLGLSVKENMSLCALDQLSK-GVQIRHADEVIAVDDFIRLFNIKTPSREQIIGNLSGGN 400
gi 218676702 322 PKDGLANGIAYISEDRKGDGLVLGLSVKENMSLCSLDLLTK-SGQIQHKDEVIAVDDFIKLFNIKTPTREQIIGNLSGGN 400
gi 229605178 322 PQDGLANGIAYISEDRKGDGLVLGLSVKENMSLCALDQLSK-GVQIRHADEVIAVDDFIRLFNIKTPSREQIIGNLSGGN 400
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 283787561 401 QQKVAIARGLMTRPEVLILDEPTRGVDVGAKKEIYQLINQFKADGLSIILVSSEMPEVLGMSDRIIVMHEGHLGGEFTRE 480
gi 117620895 402 QQKVAIAKGLLTRPKVLILDEPTRGVDVGAKKEIYQLINQFKKEGMSIILVSSEMPEVLGMSDRIMVMHEGRISAEFNTR 481
gi 147671783 401 QQKVAIAKGLMTKPKVLILDEPTRGVDVGAKKEIYQLINQFKAEGMSIILVSSEMPEVLGMSDRILVMHEGRISGEFMAS 480
gi 227811754 401 QQKVAIAKGLMTKPKVLILDEPTRGVDVGAKKEIYQLINQFKAEGMSIILVSSEMPEVLGMSDRILVMHEGRISGEFMAS 480
gi 156977359 401 QQKVAIAKGLMTKPKVLILDEPTRGVDVGAKKEIYQLINKFKADGMSIILVSSEMPEVLGMSDRIIVMHEGRITGEFDAK 480
gi 37676229  401 QQKVAIAKGLMTKPKVLILDEPTRGVDVGAKKEIYQLINKFKAEGMSIILVSSEMPEVLGMSDRILVMHEGRITGEFEAK 480
gi 27366521  401 QQKVAIAKGLMTKPKVLILDEPTRGVDVGAKKEIYQLINKFKAEGMSIILVSSEMPEVLGMSDRILVMHEGRITGEFEAK 480
gi 15600899  401 QQKVAIAKGLMTKPKVLILDEPTRGVDVGAKKEIYQLINQFKAEGMSIILVSSEMPEVLGMSDRILVMHEGRISGEFMAS 480
gi 218676702 401 QQKVAIAKGLMTKPKVLILDEPTRGVDVGAKKEIYQLINKFKADGMSIILVSSEMPEVLGMSDRIMVMHEGRVSGEFDAK 480
gi 229605178 401 QQKVAIAKGLMTKPKVLILDEPTRGVDVGAKKEIYQLINQFKAEGMSIILVSSEMPEVLGMSDRILVMHEGRISGEFMAS 480
                        490
                 ....*....|....*
gi 283787561 481 QATQEVLMAAAVGKL 495
gi 117620895 482 DANQEKLMAAAVGKQ 496
gi 147671783 481 EADQEKLMACAVGRN 495
gi 227811754 481 EADQEKLMACAVGRN 495
gi 156977359 481 DADQETLLACAVGKK 495
gi 37676229  481 HADQEKLMACAVGKK 495
gi 27366521  481 HADQEKLMACAVGKK 495
gi 15600899  481 EADQEKLMACAVGRN 495
gi 218676702 481 EANQELLLACAVGKK 495
gi 229605178 481 EADQEKLMACAVGRN 495
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap