Conserved Protein Domain Family
PRK10710

?
PRK10710: PRK10710 
DNA-binding transcriptional regulator BaeR; Provisional
Statistics
?
PSSM-Id: 182665
View PSSM: PRK10710
Aligned: 96 rows
Threshold Bit Score: 445.284
Threshold Setting Gi: 197285448
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
253689341   1 MTTAPDFAMAS-PILIVEDEPKLGQLLVDYLQAADYATHWLPNGNDVVDWVRQHSPSLILLDLMLPGCDGLTLCRTIRQF 79 
197285448   1 ----MTTTTSTySILIVEDEPKLAQLLIDYLQASDYQTQWLADGTEVIQHIKQSHYDLVLLDLMLPGKDGITLCKELRQF 76 
300723580   1 ----MSTYSTQyTVLIVEDEPKLGRLLVDYLQSADYQTAWLKRGDEVIDHVQKYQPDIILLDLMLPGLDGLSVCREIRKF 76 
290475733   1 ----MSTHSIQyTILIVEDEPKLGQLLIDYLQAADYQTQWLIRGDEVIAHVQKRQPDIILLDIMLPGLDGISICREIRRF 76 
294504581   1 MHESPLSASQSgSVLIVEDEPKLGQLLVDYLQAAGYRTQWLTNGAEVVATVRQTPPAIILLDLMLPGSDGITLCREIRRF 80 
51597134    1 MHESLLSASQSgSVLIVEDEPKLGQLLVDYLQAAGYRTQWLTNGAEVVATVRQTPPAIILLDLMLPGSDGITLCREIRRF 80 
153949110   1 MHESLLSASQSgSVLIVEDEPKLGQLLVDYLQAAGYRTQWLTNGAEVVATVRQTPPAIILLDLMLPGSDGITLCREIRRF 80 
170023569   1 MHESLLSASQSgSVLIVEDEPKLGQLLVDYLQAAGYRTQWLTNGAEVVATVRQTPPAIILLDLMLPGSDGITLCREIRRF 80 
186896226   1 MHESLLSASQSgSVLIVEDEPKLGQLLVDYLQAAGYRTQWLTNGAEVVATVRQTPPAIILLDLMLPGSDGITLCREIRRF 80 
37526668    1 ----MSTEFEHyTVLIVEDEPKLGQLLVDYLQAADYETQWLLRGDEAVSHVQQHNPDIILLDLMLPGCDGITICREIRRF 76 
253689341  80 SNVPIIMVTARSEEIDRLLGLEIGADDYICKPFSPREVVVRVRTLLRRCGWQNDgvKAIEKTETALVIDKGGFQASYLGQ 159
197285448  77 SDIPIIMVTAKTEEVDRLLGLEIGADDYICKPYSPREVVARVKTLLRRYYRPQD--IV--QNSALVIIDEQAYQIQYHNK 152
300723580  77 SDIPIVMMTAKTEEIDRLLGLEIGADDYICKPYSPREMVARVKTILRRCYRPQD----IISEQGALSIDENHFQARYLER 152
290475733  77 SDVPIVMMTARTEEIDRLLGLEIGADDYICKPYSPREMVARVKTILRRCYRPQD----IISEHGSLTIDENHFQARYLDR 152
294504581  81 SDIPIVMVTAKTEEIDRLLGLEIGADDYICKPYSPREVVARVKTILRRCSQQRH----QPTDDAPLLINESRFQASYQGH 156
51597134   81 SDIPIVMVTAKTEEIDRLLGLEIGADDYICKPYSPREVVARVKTILRRCSQQRH----QPTDDAPLLINESRFQASYQGH 156
153949110  81 SDIPIVMVTAKTEEIDRLLGLEIGADDYICKPYSPREVVARVKTILRRCSQQRH----QPTDDAPLLINESRFQASYQGH 156
170023569  81 SDIPIVMVTAKTEEIDRLLGLEIGADDYICKPYSPREVVARVKTILRRCSQQRH----QPTDDAPLLINESRFQASYQGH 156
186896226  81 SDIPIVMVTAKTEEIDRLLGLEIGADDYICKPYSPREVVARVKTILRRCSQQRH----QPTDDAPLLINESRFQASYQGH 156
37526668   77 SDVPIIMVTAKTEEIDRLLGLEIGADDYICKPYSPREIVARVKTILRRCYRPQD-----IVKQSDLHIDEACFQARYRDK 151
253689341 160 NLDLTPAEFRLLKTLSTEPGKVFSREALLDKLYDDYRVVTDRTIDSHIKNLRRKLEQLDEETSFIRTVYGIGYRWEAAPC 239
197285448 153 ILDLTTAEFRLIKALATQPGKVLSRDQLMDHLYDDYRIVTDRTIDSHIKNLRRKLEQLNDQIEFIRSIYGQGYRWETAAY 232
300723580 153 VLELTPIEFRLLKIMSSQPGRVFSRDQLLNNLYNDHRIVNDRTIDSHIKNLRRKLEQLDEDKSFIRSIYGLGYRWEAEIC 232
290475733 153 VLELTPVEFRLLKIMSSQPGRVFSRDQLLNNLYDDHRIVNDRTIDSHIKNLRRKLEQLDEDKSFIRSIYGLGYRWEAEIC 232
294504581 157 MLELTPAEFRLLKILASQPGHVFSREQLLNNLYDDYRVVTDRTIDSHIKNLRRKLELLDGEKPFIRAVYGMGYRWEAEMC 236
51597134  157 MLELTPAEFRLLKILASQPGHVFSREQLLNNLYDDYRVVTDRTIDSHIKNLRRKLELLDGEKPFIRAVYGMGYRWEAEMC 236
153949110 157 MLELTPAEFRLLKILASQPGHVFSREQLLNNLYDDYRVVTDRTIDSHIKNLRRKLELLDGEKPFIRAVYGMGYRWEAEMC 236
170023569 157 MLELTPAEFRLLKILASQPGHVFSREQLLNNLYDDYRVVTDRTIDSHIKNLRRKLELLDGEKPFIRAVYGMGYRWEAEMC 236
186896226 157 MLELTPAEFRLLKILASQPGHVFSREQLLNNLYDDYRVVTDRTIDSHIKNLRRKLELLDGEKPFIRAVYGMGYRWEAEMC 236
37526668  152 ILDLTPVEFRLLKTMASRPGQVFSRDKLLNNLYDDHRIVTDRTIDSHIKNLRRKLEQLDNSKTFIRSIYGLGYRWEADIC 231
253689341 240 NEV 242
197285448 233 RFR 235
300723580 233 RLM 235
290475733 233 RLV 235
294504581 237 RLL 239
51597134  237 RLL 239
153949110 237 RLL 239
170023569 237 RLL 239
186896226 237 RLL 239
37526668  232 RLL 234
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap