Conserved Protein Domain Family
nikE

?
PRK10419: nikE 
nickel transporter ATP-binding protein NikE; Provisional
Statistics
?
PSSM-Id: 236689
View PSSM: PRK10419
Aligned: 59 rows
Threshold Bit Score: 411.388
Threshold Setting Gi: 288957722
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 288957722   2 TILLAAEAVEKRYGGQGVFATGASKTVLRGVSLSVREGESVALLGTSGSGKSTLARLMLGLERPDGGTVRCLGRPIEALD 81
gi 148557987   1 MSLISADNIVKIYQSHSLVGASARKTVLHDISISIGQGETVALLGRSGCGKSTLARLLVGLERPASGEVRFRGVPLTKLD 80
gi 23500533    1 MSLISADNIVKIYQSHSLVGASARKTVLHDISISIGQGETVALLGRSGCGKSTLARLLVGLERPTSGEVRFRGVPLTKLD 80
gi 161620859   1 MSLISADNIVKIYQSHSLVGASARKTVLHDISISIGQGETVALLGRSGCGKSTLARLLVGLERPTSGEVRFRGVPLTKLD 80
gi 256015565   1 MSLISADNIVKIYQSHSLVGASARKTVLHDISISIGQGETVALLGRSGCGKSTLARLLVGLERPTSGEVRFRGVPLTKLD 80
gi 17988836    1 MSLISADNIVKIYQSHSLVGASARKTMLHDISISIGQGETVALLGRSGCGKSTLARLLVGLERPTSGEVRFRGVPLTKLD 80
gi 225686567   1 MSLISADNIVKIYQSHSLVGASARKTMLHDISISIGQGETVALLGRSGCGKSTLARLLVGLERPTSGEVRFRGVPLTKLD 80
gi 163844925   1 MSLISADNIVKIYQSHSLVGASARKTVLHDISISIGQGETVALLGRSGCGKSTLARLLVGLERPTSGEVRFRGVPLTKLD 80
gi 26990061    1 MSLLHVHHVGHRYRTGGLLRKRGWLQVLDGIDLQLHAGESIGLLGSSGSGKSTLARLLLGLEKPAQGQVSFAGQDVSQLK 80
gi 222102879   1 MILLQAKHLSKHYQHYSLLGASPARTVVEGVSLSIANSETVALLGRSGCGKSTLARLLAGLEQPDKGEVCFNGTALGKLA 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 288957722  82 TSGRRTFRRTVQAVFQDPLGAVNPRHRIGRIIAEPLRHLTGLDARERAARVAELLRLVGLAPEDADRLPGSMSGGQVQRV 161
gi 148557987  81 RSGMKAFRREVQLIFQDSPGAVNARSSVRAIIGEPLRHLTSLDETRREERIQELLRLVELPPEIADRLPAQVSGGQLQRI 160
gi 23500533   81 RSGMKAFRREVQLIFQDSPGAVNARSSVRAIIGEPLRHLTSLDETRREERIQELLRLVELPPEIADRLPAQVSGGQLQRI 160
gi 161620859  81 RSGMKAFRREVQLIFQDSPGAVNARSSVRAIIGEPLRHLTSLDETHREERIQELLRLVELPPEIADRLPAQVSGGQLQRI 160
gi 256015565  81 RSGMKAFRREVQLIFQDSPGAVNARSSVRAIIGEPLRHLTSLDETRREERIQELLRLVELPPEIADRLPAQVSGGQLQRI 160
gi 17988836   81 RSGMKAFRREVQLIFQDSPGAVNARSSVRAIIGEPLRHLTSLDETRREERIQELLRLVELPPEIADRLPAQVSGGQLQRI 160
gi 225686567  81 RSGMKAFRREVQLIFQDSPGAVNARSSVRAIIGEPLRHLTSLDETRREERIQELLRLVELPPEIADRLPAQVSGGQLQRI 160
gi 163844925  81 RSGMKAFRREVQLIFQDSPGAVNARSSVRAIIGEPLRHLTSLDETRREERIQELLRLVELPPEIADRLPAQVSGGQLQRI 160
gi 26990061   81 GEQARAFQRTVQLVFQDAPGAFNPQRSIGWSIAEPLRHLTDMDEAARQARTLALLEEMGLRAEHAQRLPQQLSGGQLQRA 160
gi 222102879  81 KADKAAFRRSVQMVFQDSPSAVNPRFDIRAIIDEPLRHLTNLNEADREHRLREVLDMVELPLAIASKLPGQVSGGQLQRV 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 288957722 162 CIARALAPEPRLILLDEAVSNLDLVLQLQILDLLAELRERLGTAFLFITHDVRLVRRFCHRVAVLHDGGLVEDRPVGPSI 241
gi 148557987 161 CIARALAVNPKLIILDEAVSNLDIHLQASALALLTKLQQEGGIAYLFVTHDLRLVQKFAARCLVMDEGQIVEEIKTADLD 240
gi 23500533  161 CIARALAVNPKLIILDEAVSNLDIHLQASALALLTKLQQEGGIAYLFVTHDLRLVQKFAARCLVMDEGQIVEEIKTADLD 240
gi 161620859 161 CIARALAVNPKLIILDEAVSNLDIHLQASALALLTKLQQEGGIAYLFVTHDLRLVQKFAARCLVMDEGQIVEEIKTADLD 240
gi 256015565 161 CIARALAVNPKLIILDEAVSNLDIHLQASALALLTKLQQEGGIAYLFVTHDLRLVQKFAARCLVMDEGQIVEEIKTADLD 240
gi 17988836  161 CIARALAVNPKLIILDEAVSNLDIHLQASALALLTKLQQEGGIAYLFVTHDLRLVQKFAARCLVMDEGQIVEEIKTADLD 240
gi 225686567 161 CIARALAVNPKLIILDEAVSNLDIHLQASALALLTKLQQEGGIAYLFVTHDLRLVQKFAARCLVMDEGQIVEEIKTADLD 240
gi 163844925 161 CIARALAVNPKLIILDEAVSNLDIHLQASALALLTKLQQEGGIAYLFVTHDLRLVQKFAARCLVMDEGQIVEEIKTADLD 240
gi 26990061  161 NIARALAASPQLVVLDEALSNLDRLLQLQILQQLEALRQRSGTAFVLISHDLSLVQYFCQRVVLLHGGRIVEERPVTHDL 240
gi 222102879 161 CIARALACSPKLIILDEAVSNLDLHLQTSALSLLKDLQHKTGIAYLFVTHDLRLVERFASRVLIMDAGRIVEETATGALG 240
                        250       260
                 ....*....|....*....|....*....
gi 288957722 242 AFDHPAARALLDAMLPAAPspaLRNRSAE 270
gi 148557987 241 SMRHPASRLLREAVLPPLP---VRAVETN 266
gi 23500533  241 SMRHPASRLLREAVLPPLP---VRAVETN 266
gi 161620859 241 SMRHPASRLLREAVLPPLP---VRAVETN 266
gi 256015565 241 SMRHPASRLLREAVLPPLP---VRAVETN 266
gi 17988836  241 SMRHPASRLLREAVLPPLP---VRAVETN 266
gi 225686567 241 SMRHPASRLLREAVLPPLP---VRAVETN 266
gi 163844925 241 SMRHPASRLLREAVLPPLP---VRAVETN 266
gi 26990061  241 CFAHPVGRQLQAAVLPVRP---QRRPSPQ 266
gi 222102879 241 HVSHPASLLLKSAILPAYP---RQLHN-- 264
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap