Conserved Protein Domain Family
PRK10403

?
PRK10403: PRK10403 
transcriptional regulator NarP; Provisional
Statistics
?
PSSM-Id: 182431
View PSSM: PRK10403
Aligned: 60 rows
Threshold Bit Score: 356.47
Threshold Setting Gi: 253688783
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157144856   1 MPEATPFQVLIVDDHPLMRRGIRQLLELDTAFNVVAEAGDGASAIDLASRLDLDLILLDLNMKGLSGLDTLNALRRDGVT 80
gi 218549608   3 MPETTPFQVLIVDDHPLMRRGIRQLLELDPAFEVVAEAGDGASAIDLANRLDLDLILLDLNMKGMSGLDTLNALRRDGVT 82
gi 205353364   1 --------MLIVDDHPLMRRGIRQLLELDPAFHVVAEAGDGASAIDLANRIEPDLILLDLNMKGLSGLDTLNALRRDGVT 72
gi 161502599   1 MPEVTPVQVLIVDDHPLMRRGIRQLLELDPAFHVVAEAGDGASAIDLANRIEPDLILLDLNMKGLSGLDTLNALRRDGVT 80
gi 198244741   1 MPEVTPFQVLIVDDHPLMRRGIRQLLELDPAFHVVAEAGDGASAIDLANRIEPDLILLDLNMKGLSGLDTLNALRRDGVT 80
gi 194442551   1 MPEVTPFQVLIVDDHPLMRRGIRQLLELDPAFHVVAEAGDGASAIDLANRIEPDLILLDLNMKGLSGLDTLNALRRDGVT 80
gi 207857666   1 MPEVTPFQVLIVDDHPLMRRGIRQLLELDPAFHVVAEAGDGASAIDLANRIEPDLILLDLNMKGLSGLDTLNALRRDGVT 80
gi 50120831    1 MSEKPSYRVLIVDDHPLMRRGIRQLLATDAIFDVIGEASNGVEALSLANRDSPDIILLDLNMKGLSGLDTLHALRRDGIC 80
gi 261821966   1 MSEKPSYRVLIVDDHPLMRRGIRQLLATDAIFDVIGEASNGMEALSLANRDSPDIILLDLNMKGLSGLDTLHALRRDGIC 80
gi 253688783   1 MSEKPSYRVLIVDDHPLMRRGIRQLLATDAIFDVIGEASNGMEALSLANRDSPDIILLDLNMKGLSGLDTLHALRRDGIC 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157144856  81 AQIIILTVSDSASDVYALIDAGADGYLLKDSDPEVLLEAIRAGANGGKVFSDRVSEYLRERELFGAEEDPFSVLTERELD 160
gi 218549608  83 AQIIIITVSDSASDIYALIDAGADGYLLKDSEPESLLAAIQKGANGGKVFSARVSEYLRERERFGSKDDPFSTLTERELD 162
gi 205353364  73 AQIIILTVSDSASDIYALIDAGADGYLLKDSDPEVLLEGIRKGANGGKVFSDRVNEYLRERERFGAQEDPFSILTERELD 152
gi 161502599  81 AQIIILTVSDSASDIYALIDAGADGYLLKDSDPEVLLEAIRKGANGGKVFSERVNEYLRERERFGAQEDPFSILTERELD 160
gi 198244741  81 AQIIILTVSDSASDIYALIDAGADGYLLKDSDPEVLLEAIRKGANGGKVFSDRVNEYLRERERFGAQEDPFSILTERELD 160
gi 194442551  81 AQIIILTVSDSASDIYALIDAGADGYLLKDSDPEVLLEAIRKGANGGKVFSDRVNEYLRERERFGAQEDPFSILTERELD 160
gi 207857666  81 AQIIILTVSDSASDIYALIDAGADGYLLKDSDPEVLLEAIRKGANGGKVFSDRVNEYLRERERFGAQEDPFSILTERELD 160
gi 50120831   81 ARVIVLTVSDAPSDIYALMDAGADGYLLKDSAPEHLLDSIRS----SDAFSEQVRDALRHRIAIKETPSPFTVLTERELD 156
gi 261821966  81 ARVIVLTVSDAPSDIYALMDAGADGYLLKDSAPEHLLDAIRS----SDAFSEQVRDVLRHRIAIKETPSPFTVLTERELD 156
gi 253688783  81 ARVIVLTVSDAPSDIYALMDAGADGYLLKDSAPEHLLDAIRS----SDAFSDQVRDVLRHRIAIQETPSPFTVLTERELD 156
                        170       180       190       200       210
                 ....*....|....*....|....*....|....*....|....*....|....*
gi 157144856 161 VLHELAQGLSNKQIASVLNISEQTVKVHIRNLLRKLNVRSRVAATILFLQTRGMQ 215
gi 218549608 163 VLHELAKGLSNKQIASALNISEQTVKVHIRNLLRKLNVRSRVAATILFLQHRGI- 216
gi 205353364 153 VLHELAQGLSNKQIASVLNISEQTVKVHIRNLLRKLNVRSRVAATILFLQTRGIQ 207
gi 161502599 161 VLHELAQGLSNKQIASVLNISEQTVKVHIRNLLRKLNVRSRVAATILFLQTRGM- 214
gi 198244741 161 VLHELAQGLSNKQIASVLNISEQTVKVHIRNLLRKLNVRSRVAATILFLQTRGIQ 215
gi 194442551 161 VLHELAQGLSNKQIASVLNISEQTVKVHIRNLLRKLNVRSRVAATILFLQTRGIQ 215
gi 207857666 161 VLHELAQGLSNKQIASVLNISEQTVKVHIRNLLRKLNVRSRVAATILFLQTRGIQ 215
gi 50120831  157 VLQEVASGLSNKQIAAVLYISEETVKVHIRNMLRKLNVRSRVAATVLYLETRGQ- 210
gi 261821966 157 VLQEVASGLSNKQIASVLYISEETVKVHIRNMLRKLNVRSRVAATVLYLETRGQ- 210
gi 253688783 157 VLQEVASGLSNKQIAAVLYISEETVKVHIRNMLRKLNVRSRVAATVLYLETRGQ- 210
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap