Conserved Protein Domain Family
PRK10352

?
PRK10352: PRK10352 
nickel transporter permease NikB; Provisional
Statistics
?
PSSM-Id: 182400
View PSSM: PRK10352
Aligned: 61 rows
Threshold Bit Score: 449.533
Threshold Setting Gi: 218887489
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
239905841   1 MLSYILRRLAVLPVILLAVSLVIFAILRLAPGDPAMAYLRLSQIPPTTENLALARETLGLDKPLSAQYATWLAKAARLDF 80 
256015568   1 MFAFIIRRVILLVPMLFGASLVIFLMLRLGPSDPAMDYLRLSKVPPTPQALESARQMLGLDRAITTQYFDWLGKALHGDF 80 
62317362    1 MFAFIIRRVILLVPMLFGASLVIFLMLRLGPSDPAMDYLRLSKVPPTPQALESARQMLGLDRAITTQYFDWLGKALHGDF 80 
83269339    1 MFAFIIRRVILLVPMLFGASLVIFLMLRLGPSDPAMDYLRLSKVPPTPQALESARQMLGLDRAITTQYFDWLGKALHGDF 80 
170722179   1 MLRYILLRLALLVPVMLGVSLLVFVLLHLGSTDPALDYLRLSHIPPTDAAIAEVRHTLGLDRPLYAQYLSWLWNAVHLDF 80 
83593611    1 MVSFVLKRLALLVPMLLGASLVIFLMLRLGPSDPAMDYLRLSRIPPTVQALAETRQRLGLDQPLAVQYWVWLNKALHLDF 80 
26990058    1 MLRYILLRLALLVPVMLGASLLVFVLLHLGSTDPALDYLRLSHIPPTDAAIAEVRHTLGLDRPLYAQYLSWLWNAVHLDF 80 
148557963   1 MFAFIIRRVILLVPMLFGASLVIFLMLRLGPSDPAMDYLRLSKVPPTPQALESARQMLGLDRAITTQYFDWLGKALHGDF 80 
288957719   1 MLRFIVGRLLTLPPLLLAVSVGVFLLLRLGRGDPALDYLRLSNIPPTDAAVTAAHQLLGLDRPLAEQYLSWLWQALHLDF 80 
222102876   1 MGAFILRRILLLIPMLLGASLVIFLMLRLGPSDPAMDYLRLSKVPPTPLALADARQMLGLDRPIATQYIDWLGHAFRLDF 80 
239905841  81 GRSYVTGRPVMDEILYYLPATLELAGASLLITLGLSVPMGVAAALRRDTALDHLTRAVAFAGVSIPNFWFGFLLVWLFSV 160
256015568  81 GISFATQRPVLPDLLYFLPATLQLAGVALVLTLGLSIPLGMWAARHREGWQDQVVRFVAFLGVSMPNFWLGFLLVLVFSI 160
62317362   81 GISFATQRPVLPDLLYFLPATLQLAGVALVLTLGLSIPLGMWAARHREGWQDQVVRFVAFLGVSMPNFWLGFLLVLVFSI 160
83269339   81 GISFATQRPVLPDLLYFLPATLQLAGVALVLTLGLSIPLGMWAARHREGWQDQVVRFVAFLGVSMPNFWLGFLLVLVFSI 160
170722179  81 GISYITGRPVLDDLLYYLPATLQLGGLALACTLLLSIPLGLLAARWQGRWPDHAVRAVTFLGVSMPNFWLAFLLIALFSL 160
83593611   81 GVSYATGRPVLPDLLHYLPATLHLAGVALALTLGLSIPLGMWAARRRDALPDQIVRGVAFLGVSMPNFWLGFLLVLVFSV 160
26990058   81 GISYITGRPVLDDLLYYLPATLQLGGLALACTLLLSIPLGLLAARWQGRWPDHAVRAVTFLGVSMPNFWLAFLLIALFSL 160
148557963  81 GISFATQRPVLPDLLYFLPATLQLAGVALVLTLGLSIPLGMWAARHREGWQDQVVRFVAFLGVSMPNFWLGFLLVLVFSI 160
288957719  81 GLSYVTRRPVLDDLLYYLPATLQLGAAALVVTLAVSLPLGIWAARHRDRLPDHLVRALAFAGVSIPNFWLGFLLVLLFSV 160
222102876  81 GVSYATQRPVLPDLLYYLPATLQLAGLALILTFAISIPMGVWASRHRNKLPDHIVRLVSFLGVSMPNFWLGFLLVLVFSV 160
239905841 161 QLGWLPPLGRGGLSHLVMPAVSLALMSLAVNTRLIRASMLETMHHRFILYARARGVGEGTVVWRHMFVNALIPILTATGM 240
256015568 161 QLGWLPPMGRGGFAHMIMPAIAISFMSLSINARLLRASMLEVSGQRHVRYARLRGLSERSVERSHVLRNAWLPIITATGM 240
62317362  161 QLGWLPPMGRGGFAHMIMPAIAISFMSLSINARLLRASMLEVSGQRHVRYARLRGLSERSVERSHVLRNAWLPIITATGM 240
83269339  161 QLGWLPPMGRGGFAHMIMPAIAISFMSLSINARLLRASMLEVSGQRHVRYARLRGLSERSVERSHVLRNAWLPIITATGM 240
170722179 161 WLGWLPPLGRGGAGHLVMPVLAIALMSMSINARLLRASLLEAGGQRHVIYARARGLPERHVWRDHILRNAWLPLVTATGM 240
83593611  161 ELGWLPAMGRGGAEHMIMPAVAIAFMSLSINARLLRASMLEVSGQRHVYYARLRGLSAAKVERAHILRNALLPIITATGM 240
26990058  161 WLGWLPPLGRGGAGHLVMPVLAIALMSMSINARLLRASLLDAGGQRHVTYARARGLPERHVWRDHILRNAWLPLVTATGM 240
148557963 161 QLGWLPPMGRGGFAHMIMPAIAISFMSLSINARLLRASMLEVSGQRHVRYARLRGLPERSVERSHVLRNAWLPIITATGM 240
288957719 161 TLNWLPPLGRGGLNHLVMPVAAVALMSLCINARLLRTSMLETAGQRHVLYARLRGLPERRVVQNHILRNALLPIVTATGM 240
222102876 161 QLGWLPAMGRGGFAHMIMPAIAIAFMSLSINARLLRASMLEAAGQRHVLYARLRGLSRQRVERGHILRNALLPIITATGM 240
239905841 241 HVGELLGGAVVVESVFSWPGVGRYAVSSIYNRDFPVLQCFMLVMTVIFVVCNLAVDIAYAVADPRMRLgGQGGRA 315
256015568 241 HIGELIGGTLVIESIFGWPGVGRYAVSAILNRDYPVIQCFTLVMVTIFVICNLIVDVVYAWADPRIRL-SAEGAE 314
62317362  241 HIGELIGGTLVIESIFGWPGVGRYAVSAILNRDYPVIQCFTLVMVTIFVICNLIVDVVYAWADPRIRL-SAEGAE 314
83269339  241 HIGELIGGTLVIESIFGWPGVGRYAVSAILNRDYPVIQCFTLVMVTIFVICNLIVDVVYAWADPRIRL-SAEGAE 314
170722179 241 HIGELIGGALVIETIFAWPGVGRFAVSAVLNRDFPVMQCFTLLLTGLLMVCNLIVDVCYAWLDPRSRL--EGVNA 313
83593611  241 HVGELIGGTLVIESIFGWPGVGRFAVSAIFNRDYPVIQCFTLLMVLIFVLCNLIVDIVYAWADPRIRL-AAEGAQ 314
26990058  241 HIGELLGGALVIETIFAWPGVGRFAVSAVLNRDFPVMQCFTLLLTGLLMICNLIVDVCYAWLDPRSRL--EGVNA 313
148557963 241 HIGELIGGTLVIESIFGWPGVGRYAVSAILNRDYPVIQCFTLVMVTIFVICNLIVDVVYAWADPRIRL-SAEGAE 314
288957719 241 HIGELLGGTLVIENIFGWPGVGRYAVSAIYNRDYPVLQCFTLLMTVIFVLCNLAVDVLYAWLDPRIRP-AREVGR 314
222102876 241 HVGELLGGTLVIESIFGWPGVGRYAVSAILNRDYPVIQCFTLLMVGIFVTCNLLVDIAYAWADPRIRL-SAGHVE 314
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap