Conserved Protein Domain Family
PRK10336

?
PRK10336: PRK10336 
DNA-binding transcriptional regulator QseB; Provisional
Statistics
?
PSSM-Id: 182387
View PSSM: PRK10336
Aligned: 60 rows
Threshold Bit Score: 422.382
Threshold Setting Gi: 110806919
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15833161    1 MRILLIEDDMLIGDGIKTGLSKMGFSVDWFTQGRQGKEALYSAPYDAVILDLTLPGMDGRDILREWREKGQREPVLILTA 80
gi 56415118    1 MRILLVEDDTLIGDGIKAGLSKMGFSVDWFTEGRPGKEALYSAPYDAVILDLTLPGMDGRDILREWREKGKQEPVLILTA 80
gi 206577736   1 MRILLVEDDKLIGDGIKAGLSKMGFSIDWFTAGLEGKNALYSAPYDAAILDLTLPGIDGLDILREWRDKGRHEPVLILTA 80
gi 288933539   1 MRILLVEDDKLIGDGIKAGLSKMGFSIDWFTAGLEGKNALYSAPYDAAILDLTLPGIDGLDILREWRDKGRHEPVLILTA 80
gi 238896533   1 MRILLVEDDKLIGDGIKAGLSKMGFSIDWFTAGLEGKNALYSAPYDAAILDLTLPGIDGLDILREWRDKGRHEPVLILTA 80
gi 161616164  52 MRILLVEDDTLIGDGIKAGLSKMGFSVDWFTEGRPGKEALYSAPYDAVILDLTLPGMDGRDILREWREKGKQEPVLILTA 131
gi 146313065   1 MRILLVEDDKLIGDGLKAGLTKMGFSVDWFTDGGTGKTALYSAPYDAVVLDLTLPGMDGLDILREWREKGRSEPVLILTA 80
gi 62181691   52 MRILLVEDDTLIGDGIKAGLSKMGFSIDWFTEGRPGKEALYSAPYDAVILDLTLPGMDGRDILREWREKGKQEPVLILTA 131
gi 152971957   1 MRILLVEDDKLIGDGIKAGLSKMGFSIDWFTAGLEGKNALYSAPYDAAILDLTLPGIDGLDILREWRDKGRHEPVLILTA 80
gi 161506258  52 MRILLIEDDTLIGDGIKAGLSKMGFSVDWFTEGRPGKEALYSAPYDAVILDLTLPGMDGRDILREWREKGKQEPVLILTA 131
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15833161   81 RDALEERVEGLRLGADDYLCKPFALIEVAARLEALMRRTNGQASNELRHGNVMLDPGKRIATLAGEPLTLKPKEFALLEL 160
gi 56415118   81 RDALAERVEGLRLGADDYLCKPFALIEVAARLEALVRRASGQASSELRHGQVTLNPGNLVATLAGEPLALKPKEFALLEL 160
gi 206577736  81 RDALSQRVEGLRLGADDYLCKPFALIEVAARLEALIRRAHGQSSSELRHGKVSLDPNRLTASLDGESLVLKPKEFALLEL 160
gi 288933539  81 RDALSQRVEGLRLGADDYLCKPFALIEVAARLEALIRRAHGQSSSELRHGKVSLDPNRLTASLDGESLVLKPKEFALLEL 160
gi 238896533  81 RDALSQRVEGLRLGADDYLCKPFALIEVAARLEALIRRAHGQSSSELRHGKVILDPNRLTASLDGESLALKPKEFALLEL 160
gi 161616164 132 RDALAERVEGLRLGADDYLCKPFALIEVAARLEALVRRASGQASSELRHGQVTLNPGNLVATLAGEPLALKPKEFALLEL 211
gi 146313065  81 RDALYQRVEGLRLGADDYLCKPFALVEVAARLEALVRRSHGQTRSELRHGNVTLDPVSLVAKLDGETLPLKPKEFALLEL 160
gi 62181691  132 RDALAERVEGLRLGADDYLCKPFALIEVAARLEALVRRASGQASSELHHGQVTLNPGNLVATLAGEPLALKPKEFALLEL 211
gi 152971957  81 RDALNQRVEGLRLGADDYLCKPFALIEVAARLEALIRRAHGQSSSELRHGKVILDPNRLTASLDGESLALKPKEFALLEL 160
gi 161506258 132 RDALAERVEGLRLGADDYLCKPFALIEVAARLEALVRRASGQASSELRHGQVTLNPGNLVATLADAPLALKPKEFALLEL 211
                        170       180       190       200       210
                 ....*....|....*....|....*....|....*....|....*....|....*....
gi 15833161  161 LMRNAGRVLPRKLIEEKLYTWDEEVTSNAVEVHVHHLRRKLGSDFIRTVHGIGYTLGEK 219
gi 56415118  161 LLRNKGRVLPRKLIEEKLYNWDDDVSSNAVEVHVHHLRRKLGSEFIRTVHGIGYTLGDA 219
gi 206577736 161 LLRNAGRVLPRKLIEEKLYTWDDEVSSNAVEVHVHHLRRKLGSGFIRTVHGIGYTLGDA 219
gi 288933539 161 LLRNAGRVLPRKLIEEKLYTWDDEVSSNAVEVHVHHLRRKLGSGFIRTVHGIGYTLGDA 219
gi 238896533 161 LMRNAGRVLPRKLIEEKLYTWDDEVSSNAVEVHVHHLRRKLGSDFIRTVHGIGYTLGDA 219
gi 161616164 212 LLRNKGRVLPRKLIEEKLYNWDDDVSSNAVEVHVHHLRRKLGSEFIRTVHGIGYTLGDA 270
gi 146313065 161 LMRNAGRVLPRKNIEEKLYTWDDDVSSNAVEVHVHHLRRKLGSHFIRTVHGIGYTLGDV 219
gi 62181691  212 LLRNKGRVLPRKLIEEKLYNWDDDVSSNAVEVHVHHLRRKLGSEFIRTVHGIGYTLGDA 270
gi 152971957 161 LMRNAGRVLPRKLIEEKLYTWDDEVSSNAVEVHVHHLRRKLGSDFIRTVHGIGYTLGDA 219
gi 161506258 212 LMRNKGRVLPRKLIEEKLYNWDDDVSSNAVEVHVHHLRRKLGSEFIRTVHGIGYTLGDA 270
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap