Conserved Protein Domain Family
PRK10261

?
PRK10261: PRK10261 
glutathione transporter ATP-binding protein; Provisional
Statistics
?
PSSM-Id: 182342
View PSSM: PRK10261
Aligned: 63 rows
Threshold Bit Score: 1142.67
Threshold Setting Gi: 206578247
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 156934672   1 MPKSDVLPEEQVLSVSGLSVRF-KDESGTTDAVRQLSFSLKRGETLAIVGESGSGKSVTALSLMRLIEQAGGEMESGPLL 79
gi 283784593   1 -----------MLTVSNLNIAF-HQDRLRFPAVRNLSFRLKRGETLAIVGESGSGKSVTALALMRLIEQSGGEVQSERML 68
gi 296103231   1 MPHSEELDNREVLAVHQLNIAF-QEERQFIPAVENLSFSLKRGETLAIVGESGSGKSVTALALMRLLEQTGGQISSEKML 79
gi 146310981   1 MPQRNDLDSQQVLAVHNLNIAF-QEERRPVPAVKHLSFSLKRGETLAIVGESGSGKSVTALSLMRLLEQSGATVECDSML 79
gi 288936369   1 MSQTHETDTCEVLVVRNLNVAFrQQDAPEVQAVRQLSFSLRRGETLAIVGESGSGKSVTALALMRLLDAASSEVSSEGLW 80
gi 152969419   1 MSQTHETDTCEVLVVRNLNVAFrQQDAPEVQAVRQLSFSLRRGETLAIVGESGSGKSVTALALMRLLDAASSEVNSEGLW 80
gi 206578247   1 MSQTHETDTCEVLVVRNLNVAFrQQDAPEVQAVRQLSFSLRRGETLAIVGESGSGKSVTALALMRLLDAASSEVSSEGLW 80
gi 62179413   34 VPHSDELDSRDVLSVSGLNIAF-HHEGQQVDAVRNVSLRLKRGETLAIVGESGSGKSVTALALMRLIEQSGANVRCGEML 112
gi 161503983   1 MPHSDELDSRDVLSVRGLNIAF-HHEEQQVDAVRNLSLCLKRGETLAIVGESGSGKSVTALALMRLIEQADANVRCGEML 79
gi 224582660   1 MPHSDELDSRDVLSVSGLNIAF-HHEGQQVDAVRNVSLRLKRGETLAIVGESGSGKSVTALALMRLIEQSGANVRCGEML 79
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 156934672  80 LRRRSEQVIDLRTFSQKQMRDVRGADMAMIFQEPMTSLNPVFPVGEQIAESIRLHQGFGRERAMREAKRMLDLVRIPESE 159
gi 283784593  69 LRRRNRQVIELGEQSASQLQRIRGADMAMIFQEPMTSLNPVFTVGEQIAESVRLHQGLGREEAMAQARRMLEQVRIPEAK 148
gi 296103231  80 LRRRNRQVIDLNELSAAQMQGVRGADIAMIFQEPMTSLNPVFPVGEQIAESIRLHQGLSGDEALLEAKRMLELVRIPESQ 159
gi 146310981  80 LRKRSQKVVSLMDMSQSQMQSVRGADMAMIFQEPMTSLNPVFPVGEQIAESIRLHQGLNREDALAEAKRMLEQVRIPEAQ 159
gi 288936369  81 LRRRNRQVIALNEQTDAEMRRVRGADLAMIFQEPMTSLNPVFTIGEQIAESLRLHQGLGREEALRAAKKMLDQVRIPQAE 160
gi 152969419  81 LRRRNRQVIALNEQTDAEMRRVRGADLAMIFQEPMTSLNPVFTIGEQIAESLRLHQGLGREEALRAAKKMLDQVRIPQAE 160
gi 206578247  81 LRRRNRQVIALNEQTDAEMRRVRGADLAMIFQEPMTSLNPVFTIGEQIAESLRLHQGLGREEALRAAKKMLDQVRIPQAE 160
gi 62179413  113 LRRRNRQVIELSEQSDAQMRRVRGADIAMIFQEPMTSLNPVFTVGEQIAESIRLHQRASHEEALAEAKRMLDQVRIPESQ 192
gi 161503983  80 LRRRNRQVIELSEQSDAQMRRVRGADIAMIFQEPMTSLNPVFTVGEQIAESIRLHQGASHEEALAEAKRMLDQVRIPEPQ 159
gi 224582660  80 LRRRNRQVIELSEQSDAQMRRVRGADIAMIFQEPMTSLNPVFTVGEQIAESIRLHQRASHEEALAEAKRMLDQVRIPESQ 159
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 156934672 160 AMLARFPHQLSGGMRQRVMIAMALSCRPAVLIADEPTTALDVTIQAQILQLIRVLQQEMSMGVIFITHDMGVVANMADRV 239
gi 283784593 149 MVLSRYPHQLSGGMRQRVMIAMALSCRPAVLIADEPTTALDVTIQAQILQLINVLQQEMSMGVIFITHDMGVVADVADRV 228
gi 296103231 160 SILGRYPHQLSGGMRQRVMIAMALSCRPAVLIADEPTTALDVTIQAQILQLIKVLQQEMEMGVMFITHDMGVVADIADRV 239
gi 146310981 160 TILSRYPHQLSGGMRQRVMIAMALSCRPAVLIADEPTTALDVTIQAQILQLIKVLQQDMDMGVIFITHDMGVVADIADRV 239
gi 288936369 161 EMLSRYPHQLSGGMRQRVMIAMALSCRPAVLIADEPTTALDVTIQAQILQLIAVLQKEMAMGVIFITHDMGVVADIADRV 240
gi 152969419 161 EMLSRYPHQLSGGMRQRVMIAMALSCRPAVLIADEPTTALDVTIQAQILQLIAVLQKEMAMGVIFITHDMGVVADIADRV 240
gi 206578247 161 EMLSRYPHQLSGGMRQRVMIAMALSCRPAVLIADEPTTALDVTIQAQILQLIAVLQKEMAMGVIFITHDMGVVADIADRV 240
gi 62179413  193 AILSRYPHQLSGGMRQRVMIAMALSCRPAVLIADEPTTALDVTIQAQILQLIKVLQQEMSMGVIFITHDMGVVADIADRV 272
gi 161503983 160 AILSRYPHQLSGGMRQRVMIAMALSCRPAVLIADEPTTALDVTIQAQILQLIKVLQQEMSMGVIFITHDMGVVADIADRV 239
gi 224582660 160 AILSRYPHQLSGGMRQRVMIAMALSCRPAVLIADEPTTALDVTIQAQILQLIKVLQQEMSMGVIFITHDMGVVADIADRV 239
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 156934672 240 LVMYQGEAVESGSVEEIFRRPAHPYTRSLLAAVPRLGAMNGTDLPRKFPLNHAPRCDMDSPDAEQDTVVpDSEPILQVRD 319
gi 283784593 229 LVMYQGEAVETGDVQQIFRAPQHPYTRALLAAVPKLGAMKGLPYPRRFPLISLNEPEKREPQTDQNTVV-EGEPILQVRN 307
gi 296103231 240 LVMHQGRAVETGTVEQIFHAPAHPYTKALLAAVPRLGAMNGSDLPRRFPLISLEAAGRQEEETEQDTVV-PGKPILEVRD 318
gi 146310981 240 LVMYQGEAVETGSVEQIFHAPQHPYTKALLAAVPRLGAMNGSDLPRRFPLISMNDPQRQEAETEQDTVV-PGEPILQVRD 318
gi 288936369 241 LVMYRGEAVETGSVEEIFRSPQHPYTQSLLAAVPRLGEMRGQDLPRRFSLPGQPQAETETP----DTVA-AGEPILQVRD 315
gi 152969419 241 LVMYRGEAVETGSVEEIFRSPQHPYTQSLLAAVPRLGEMRGQDLPRRFPLPGQPLAESETP----DTVV-AGEPILQVRD 315
gi 206578247 241 LVMYRGEAVETGSVEEIFRSPQHPYTQSLLAAVPRLGEMRGQDLPRRFSLPGQPQAETETP----DTVA-AGEPILQVRD 315
gi 62179413  273 LVMYQGEAVETGSVEQIFHAPTHPYTQTLLAAVPQLGAMRGHSLPRRFPLISADEPALYESQIEQDTVV-EGEPILQVRG 351
gi 161503983 240 LVMYQGEAMETGSVEQIFHAPTHPYTQTLLAAVPQLGAMRGHSLPRRFPLISADEPAPYESQIEQDTVV-EGEPILQVRG 318
gi 224582660 240 LVMYQGEAVETGSVEQIFHAPTHPYTQTLLAAVPQLGAMRGHSLPRRFPLISADEPALYESQIEQDTVV-EGEPILQVRG 318
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 156934672 320 LVTRFPVRSGIFNRVKREVHAVEKVSFDLWPGETLSLVGESGCGKSTTGRSLLRLVETQGGSITFGGRRIDTLSDSAMQA 399
gi 283784593 308 LVTRFPLRSGILNRVTREVHAVENVSFDLWPGETLSLVGESGCGKSTTGRALLRLVDTQAGEIIFQGQRIDNLPARQLQS 387
gi 296103231 319 LVTRFPLRSGIFNRVKREVHAVENVSFDLWPGETLALVGESGCGKSTTGRALLRLVESQEGSITFNGERIDTLPDSKLQA 398
gi 146310981 319 LVTRFPLRGGILNRVKREVHAVENVSFDLWPGETLALVGESGCGKSTTGRALLRLVESQEGSIIFNGKRIDTLSASQLQP 398
gi 288936369 316 LVARFPVRGGLLNRVTREVHAVEKISFDLWPGETLSLVGESGCGKSTTGRALLRLVETQGGTITFDGQRIDTLSGSKLQS 395
gi 152969419 316 LVARFPVRGGLLNRVTREVHAVEKVSFDLWPGETLSLVGESGCGKSTTGRALLRLVETQGGTITFDGQRIDTLAGGKLQA 395
gi 206578247 316 LVARFPVRGGLLNRVTREVHAVEKVSFDLWPGETLSLVGESGCGKSTTGRALLRLVETQGGTITFDGQRIDTLSGSKLQS 395
gi 62179413  352 LVTRFPLRSGLFNRVTREVHAVENISFDLWPGETLSLVGESGSGKSTTGRALLRLVESRQGEIIFNGQRIDTLSAGKLQP 431
gi 161503983 319 LVTRFPLRSGLFNRVTREVHAVENISFDLWPGETLSLVGESGSGKSTTGRALLRLVESRQGEIIFNGQRIDTLSAGKLQP 398
gi 224582660 319 LVTRFPLRSGLFNRVTREVHAVENISFDLWPGETLSLVGESGSGKSTTGRALLRLVESRQGEIIFNGQRIDTLSAGKLQP 398
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 156934672 400 VRRDMQFIFQDPYASLDPRLTVGYSIMEPLLVHRLLDGEAARKRVAWLLERVGLKPEHAWRYPHEFSGGQRQRICIARAL 479
gi 283784593 388 LRRDIQFIFQDPYASLDPRQTVGYSIMEPLRVHGLLNGDAAAKRVAWLLERVGLLPEHAWRYPHEFSGGQRQRICIARAL 467
gi 296103231 399 VRRNIQFIFQDPYASLDPRHTVGYSIMEPLRVHNLLDGEAAQRRVAWLLERVGLKPEHAWRYPHEFSGGQRQRICIARAL 478
gi 146310981 399 LRRDIQFIFQDPYASLDPRQTVGYSIMEPLRVHGLLQGEEAQRRVSWLLERVGLKPEHAWRYPHEFSGGQRQRICIARAL 478
gi 288936369 396 LRRNIQFIFQDPYASLDPRQTVGDSIMEPLRVHGLLHGEAARERVSWLLKRVGLQPEHAWRYPHAFSGGQRQRICIARAL 475
gi 152969419 396 LRRNIQFIFQDPYASLDPRQTVGDSIMEPLRVHGLLRGEAARERVAWLLKRVGLQPEHAWRYPHAFSGGQRQRICIARAL 475
gi 206578247 396 LRRNIQFIFQDPYASLDPRQTVGDSIMEPLRVHGLLHGEAARERVSWLLKRVGLQPEHAWRYPHAFSGGQRQRICIARAL 475
gi 62179413  432 LRRDIQCIFQDPYASLDPRQTVGYSIMEPLRIHGLGQGDAAAKRVAWLLERVGLRPEHAWRYPHEFSGGQRQRICIARAL 511
gi 161503983 399 LRRDIQCIFQDPYASLDPRQTVGYSIMEPLRIHGLGQGDAAAKRVAWLLERVGLRPEHAWRYPHEFSGGQRQRICIARAL 478
gi 224582660 399 LRRDIQCIFQDPYASLDPRQTVGYSIMEPLRIHGLGQGDAAAKRVAWLLERVGLRPEHAWRYPHEFSGGQRQRICIARAL 478
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 156934672 480 ALNPKVVIADESVSALDVSIRAQIINLLLDLQRDFGISFLFISHDMAVVERISHRVAVMYLGQIVEIGPRRAVFENPQHP 559
gi 283784593 468 ALNPKVIIADEAVSALDVSIRGQIINLLLDLQRDLGIAYLFISHDMAVVERISHRVAVMNRGRIVEMGPRAALFENPQHP 547
gi 296103231 479 ALNPKVVIADESVSALDVSIRAQIINLLLDLQRDLGIAFLFISHDMAVVERISHRVAVMYLGQIVEIGPRRAVFENPQHP 558
gi 146310981 479 ALNPKVVIADESVSALDVSIRAQIINLLLDLQRDLGIAFLFISHDMAVVERISHRVAVMYMGQIVEIGPRRAVFENPQHP 558
gi 288936369 476 ALNPKVVIADESVSALDVSIRAQIINLMLDLQREMGIAFLFISHDMAVVERISHRVAVMYRGRIVEIGPRRAVFENPQHP 555
gi 152969419 476 ALNPKVVIADESVSALDVSIRAQIINLMLDLQREMGIAFLFISHDMAVVERISHRVAVMYRGRIVEIGPRRAVFENPQHP 555
gi 206578247 476 ALNPKVVIADESVSALDVSIRAQIINLMLDLQREMGIAFLFISHDMAVVERISHRVAVMYRGRIVEIGPRRAVFENPQHP 555
gi 62179413  512 ALNPKVIIADEAVSALDVSVRGQIINLLLDLQREMGIAYLFISHDMAVVERISHRVAVMYLGQIVEMGPRRAVFENPQHP 591
gi 161503983 479 ALNPKVIIADEAVSALDVSVRGQIINLLLDLQREMGIAYLFISHDMAVVERISHRVAVMYLGRIVEMGTRRAVFENPQHP 558
gi 224582660 479 ALNPKVIIADEAVSALDVSVRGQIINLLLDLQREMGIAYLFISHDMAVVERISHRVAVMYLGQIVEMGPRRAVFENPQHP 558
                        570       580       590       600       610       620
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 156934672 560 YTRKLMAAVPVADPGHPRRQPVLLSDEIPSATRPKGDAPFVAPLVQVGQGHYVARHPVGATDHHF 624
gi 283784593 548 YTRKLMAAVPVADPGRPRPQRVLLSDELPGNIYRRGEAVAPVSLQQVGPGHYVAPAQQENALSRL 612
gi 296103231 559 YTRKLMSAVPVADPEHRHGQRVLLQDEMPSNIRKRGEVMERVTLREVGPGHFVAPPRQDNAFSRL 623
gi 146310981 559 YTRKLMAAVPVADPAHRHGQRVLLQDEMPGNIRKRGERAERVELREVGPGHFVAPPRQNNAFSRL 623
gi 288936369 556 YTRKLMAAVPVADPAYRHPQRVLLSDDVPGNIYKRGEEMASVPLQQVGPDHFVARESAD-VLGRA 619
gi 152969419 556 YTRKLMAAVPVADPGHRHPQRVLLSDDVPGNIYKRGEEIASVPLQQVGPGHFVARESAD-VLGRT 619
gi 206578247 556 YTRKLMAAVPVADPAYRHPQRVLLSDDVPGNIYKRGEEMVSVPLQQVGPDHFVARESAD-VLGRA 619
gi 62179413  592 YTRKLMAAVPVADPSRHRPRRVLLSDDIPSNIHKRGEETPAVSLQLVGPGHYVARPLQDNALSRL 656
gi 161503983 559 YTRKLMAAVPVADPFRHRPRRVLLSDDIPSNIHKRGEETPAVSLQLVGPGHYVARPLQDNALSRL 623
gi 224582660 559 YTRKLMAAVPVADPSRHRPRRVLLSDDIPSNIHKRGEETPAVSLQLVGPGHYVARPLQDNALSRL 623
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap