Conserved Protein Domain Family
PRK10258

?
PRK10258: PRK10258 
biotin biosynthesis protein BioC; Provisional
Statistics
?
PSSM-Id: 182340
View PSSM: PRK10258
Aligned: 62 rows
Threshold Bit Score: 382.184
Threshold Setting Gi: 156934735
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157146590   1 MAQVDKQAIAAAFGRAASHYEQHAELQRQSADALLALLAGRECAHVLDAGCGPGRMSRFWREQGCEVTALDLSAQMLDEA 80
gi 283784537   1 MTQVNKQAIAAAFGRAAGQYEQHAQLQRLSAEALLALLPQRTYEQVLDAGCGPGLLSRYWRARGSMVAALDLSSQMLNEA 80
gi 296103298   1 MSPVNKQAIAAAFGRAARSYSQHDELQRQSAQGLLELLGARRFPYVLDAGCGPGGNSRYWRDAGSHVTALDLSEQMLDEA 80
gi 146310926   1 MPQVNKQAIASAFGRAARCYSQHDELQRQSAQGLHAFLGDQRFNAVLDAGCGPGTNSRVWRERGSHVTAFDLSPQMIEQA 80
gi 288936433   1 MVTVNKQAVAAAFGRAASGYTQHDELQRRSADLLLRQLARRDFAQVLDAGCGPGSMSRYWREAGSVVTALDLSAGMLAQA 80
gi 152969359   1 MATVNKQAVAAAFGRAASGYTQHDELQRRCADLLLRQLARRDFAQVLDAGCGPGSMSRYWREAGSVVTALDLSAGMLAQA 80
gi 238893822  13 MATVNKQAVAAAFGRAASGYTQHDELQRRCADLLLRQLARRDFAQVLDAGCGPGSMSRYWREAGSVVTALDLSAGMLAQA 92
gi 206578655   1 MVTVNKQAVAAAFGRAASGYTQHDELQRRSADLLLRQLARRDFAQVLDAGCGPGSMSRYWREAGSVVTALDLSAGMLAQA 80
gi 161504037   1 MAQVNKQAIAAAFGRAASQYEQHAFLQQQSADALLTMLAGRQFASVLDAGCGPGRMSRYWRERGSEVTALDLSLPMLLQA 80
gi 197363024   1 MAQVNKQAIAAAFGRAASQYEQHASLQQHSADALLTLLTGRQFTSVLDAGCGPGRMSRYWRERGSEVTALDLSLPMLQQA 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157146590  81 RRQQAAHHYLAADIEAIPLAAARFDLAWSNLAVQWCGDLRGALSELYRVVRPGGVVAFTSLAHGSLPELRQAWQAVDNRG 160
gi 283784537  81 RRQNRAHYYLAGDIESLPLAEATFDLAWSNLAVQWCNDLRGALSELYRVARPGGKVAFTTLANGSLPELRQAWRAVDNQH 160
gi 296103298  81 RQQQAADRYLTGDIESLPLPDAQFDLVWSHLAVQWCSSLSQALNELYRVARPGGKVAFTTLLESSLPELNQAWKAVDEQP 160
gi 146310926  81 RYQQAADDYQVGDIESMTLSDAQFDLVWSHLAVQWCASLTQALRELYRVTRPGGTLAFTTLLAHSLPELNQAWQAVDERP 160
gi 288936433  81 QRHDAAQHYLQGDIEALPLPDGCVDLAWSNLAVQWCDDLRAAIGELCRVVRPGGRVAFTTLLAGSLPELNQAWQAIDDRP 160
gi 152969359  81 QRNDAAQHYLLGDIEALPLPDACVDLAWSNLAVQWCDDLRAAIGELYRVARPGGRVAFSTLLADSLPELNQAWQAIDDRP 160
gi 238893822  93 QRNDAAQHYLLGDIEALPLPDACVDLAWSNLAVQWCDDLRAAIGELYRVARPGGRVAFSTLLADSLPELNQAWQAIDDRP 172
gi 206578655  81 QRHDAAQHYLQGDIEALPLPDGCVDLAWSNLAVQWCDDLRAAIGELCRVVRPGGRVAFTTLLAGSLPELNQAWQAIDDRP 160
gi 161504037  81 RDRKAAHHYLLADIEAIPYVSGVFDLAWSNLAVQWCGDLRGALSELCRVVRPGGTVAFTTLCQGSLPELRQAWQAVDNRT 160
gi 197363024  81 RDRQAAHHYLLADIEAIPHDAEVFDLAWSNLAVQWCGDLRDALSELYRVVRPGGVVAFTTLCQGSLPELRQAWQAVDNRA 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157146590 161 HANHFLSPEAIGNAMHGWRVRQQIQAITLWFDDALSAMRSLKGIGATHLHEGREPRVLTRSQLRQLQLAWPQQQGKYPLT 240
gi 283784537 161 HANRFLPQTALHDALRGWRSESRLQSITLWFDDPLSAMRSLKGIGATHLHGGREARVLSRAQLQTLRLAWPQRQGKYPLT 240
gi 296103298 161 HANRFLAYDQVTDALTGWRFRSQVQTITLNFSDAFSAMRSLKGIGATHLHAGRERKPLTRGQLQRLELAWPQRRGTFPLS 240
gi 146310926 161 HANRFLSEAEVISALQGWRYRATTQTVTLTFVDALSAMRSLKGIGATHLHDGRGRKPLTRGELQRLEFAWPQQRGEFPLS 240
gi 288936433 161 HANRFLSEPAVRAALSGLRAEGVVHQISLPFADALSAMRSLKGIGATHLHQGRASAPLGRGKLRELQLAWPQQQGICPLT 240
gi 152969359 161 HANRFLSEAAVRAALSGLRATGEVHQISLPFADALSAMRSLKGIGATHLHQGRTAAPLGRGKLRELQLAWPQRQGICPLT 240
gi 238893822 173 HANRFLSEAAVRAALRGLRATGEVHQISLPFADALSAMRSLKGIGATHLHQGRTAAPLGRGKLRELQLAWPQRQGICPLT 252
gi 206578655 161 HANRFLSEPAVRAALSGLRAEGVVHQISLPFADALSAMRSLKGIGATHLHQGRASAPLGRGKLRELQLAWPQQQGICPLT 240
gi 161504037 161 HANSFLPEEAIDHALHGWRAYRQTQAITLCFEDALSAMRSLKGIGATHLHEGREPDVLTRARLRQIQLAWPQRQGKYPLT 240
gi 197363024 161 HANSFLPEEAIDHALRGWRASRHTQAMTLWFEDALSAMRSLKSIGATHLHEGRESDVLTRARLRQIQLAWPQRQGKYPLT 240
                        250
                 ....*....|.
gi 157146590 241 YQLFLGVIERD 251
gi 283784537 241 YHFFAGVIERD 251
gi 296103298 241 YQLFHGIIERD 251
gi 146310926 241 YQLFHGIIERD 251
gi 288936433 241 YYLFTGVIERD 251
gi 152969359 241 YSLFTGVIERD 251
gi 238893822 253 YSLFTGVIERD 263
gi 206578655 241 YYLFTGVIERD 251
gi 161504037 241 YHLFMGVIERD 251
gi 197363024 241 YHLFMGVIERD 251
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap