Conserved Protein Domain Family
PRK10246

?
PRK10246: PRK10246 
exonuclease subunit SbcC; Provisional
Statistics
?
PSSM-Id: 182330
View PSSM: PRK10246
Aligned: 63 rows
Threshold Bit Score: 1492.76
Threshold Setting Gi: 156935056
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 156935056    1 MKILTLRLKNLNSLKGEWKIDFTAEPFASNGLFAITGPTGAGKTTLLDAICLALYHRTPRLNALSQSQNDLMTRDTAECL 80
gi 283784212    1 MKILSLRLKNLNSLKGEWKVDFTAEPFASNGLFAITGPTGAGKTTLLDAICLALYHKTPRLNTVSQSQNDLMTRDTAECL 80
gi 296101516    1 MKILSLRLKNLNSLKGEWKIDFTAEPFASNGLFAITGATGAGKTTLLDAICLALYHETPRLQKVSQAQNDLMTRDTAECL 80
gi 146310526    1 MKILSLRLKNINSLKGEWKIDFTAEPFASNGLFAITGATGAGKTTLLDAICLALYHQTPRLNKVTQSQNDLMTRDTAECL 80
gi 288936895    1 MKILSLRLKNLNSLKGEWKIDFTAEPFVSNGLFAITGATGAGKTTLLDAICLALYHETPRLNKVSQSQNDLMTRDTAECL 80
gi 152968911    1 MKILSLRLKNLNSLKGEWKIDFTAEPFASNGLFAITGATGAGKTTLLDAICLALYHETPRLNKVSQSQNDLMTRDTAECL 80
gi 206578945    1 MKILSLRLKNLNSLKGEWKIDFTAEPFVSNGLFAITGATGAGKTTLLDAICLALYHETPRLNKVSQSQNDLMTRDTAECL 80
gi 16759372     1 MKILSLRLKNLNSLKGEWKVDFTAEPFASNGLFAITGPTGAGKTTLLDAICLALYHETPRLNTVSQSQNDLMTRDTAECL 80
gi 161504420    1 MKILSLRLKNLNSLKGEWKVDFTAEPFASNGLFAITGPTGAGKTTLLDAICLALYHETPRLNTVSQSQNDLMTRDTAECL 80
gi 194735358    1 MKILSLRLKNLNSLKGEWKVDFTAEPFASNGLFAITGPTGAGKTTLLDAICLALYHETPRLNTVSQSQNDLMTRDTAECL 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 156935056   81 AEVEFEVKGVAWRAFWSQSRARGQPDGNLQAPRVELARCEDGKIVADKIKDKLDRIAALTGLDYDRFTRSMMLSQGQFAA 160
gi 283784212   81 AEVEFEVKGDAYRAFWSQNRARNQADGNLQAPRVELARCADGKILADKVKDKLELTAELTGLDYGRFTRSMLLSQGQFAA 160
gi 296101516   81 AEVEFEVKGIAYRAFWSQNRARNQPDGNLQAPRVELARCEDGKILADKVTDKLEQTAALTGLDYSRFTRSMLLSQGQFAA 160
gi 146310526   81 AEVEFEVKGTAYRAFWSQSRARNQPDGNLQAPRVELARCEDGKILSDKATDKIEQTATLTGLDYDRFTRSMLLSQGQFAA 160
gi 288936895   81 AEVEFEVKGTAYRAFWSQNRARNQPDGNLQAPRVELARCADGKILADKVSDKLEQTATLTGLDYGRFTRSMLLSQGQFAA 160
gi 152968911   81 AEVEFEVKGIAYRAFWSQNRARNQPDGNLQAPRVELARCADGKILADKVSDKLEQTATLTGLDYGRFTRSMLLSQGQFAA 160
gi 206578945   81 AEVEFEVKGTAYRAFWSQNRARNQPDGNLQAPRVELARCADGKILADKVSDKLEQTATLTGLDYGRFTRSMLLSQGQFAA 160
gi 16759372    81 AEVEFEVKGEAWRAFWSQNRARNRPDGNLQAPRVELARCSDGKIFADKVKDKLEMIATLTGLDYGRFTRSMLLSQGQFAA 160
gi 161504420   81 AEVEFEVKGEAWRAFWSQNRARNQPDGNLQAPRVELARCADGKIVADKVKDKLEMIATLTGLDYGRFTRSMLLSQGQFAA 160
gi 194735358   81 AEVEFEVKGETWRAFWSQNRARNQPDGNLQAPRVELARCSDGKIFADKVKDKLEMIATLTGLDYGRFTRSMLLSQGQFAA 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 156935056  161 FLNAEAKARAELLEELTGTEIYGQVSARIFEQHKEARSQLEKLESQAQGVRLLDEAQRESLTTGLQALTDEEKTLLARQR 240
gi 283784212  161 FLNAEPKERAELLEELTGTEIYGQISAMVFEQHKAARSELEKLQAQASSVALLAPEAVQALTDSLQALTDEEKQLAARQQ 240
gi 296101516  161 FLNAKPGDRAELLEELTGTEIYGQISAMVFEKHKAARNALEMCEAQAAGVVLLSEAQQQQLQQSLQALTDEEKTLLTQQQ 240
gi 146310526  161 FLNAKPGERAELLEELTGTEIYGQISARVFEQHKAARTELEKREAQAAGVILLSEEQQQQLTQSLQALTDEEKMLLVQQQ 240
gi 288936895  161 FLNAKPSDRAELLEELTGTEIYGQISAMVYEQHKAARHALEKFEAQAAGIVLLTEAQQQALQESLQVLTDEEKTLLTQQQ 240
gi 152968911  161 FLNAKPSDRAELLEELTGTEIYGQISAMVYEQHKAARHALEKFEAQAAGIVLLTEAQQQALQESLQVLTDEEKALLAQQQ 240
gi 206578945  161 FLNAKPSDRAELLEELTGTEIYGQISAMVYEQHKAARHALEKFEAQAAGIVLLTEAQQQALQESLQVLTDEEKTLLTQQQ 240
gi 16759372   161 FLNAKAKERAELLEELTGTEIYGQISAQVFEKHKSARLELEKLQAQASGVALLADEQLQQLEASLQALTDEEKRLLADQQ 240
gi 161504420  161 FLNAKAKERAELLEELTGTEIYGQISAQVFEKHKTARLELEKLQAQVSGVALLAEEQLQQLVASLQALTDEEKRLLASQH 240
gi 194735358  161 FLNAKAKERAELLEELTGTEIYGQISAQVFEKHKSARLELEKLQAQASGVALLADEQLQQLEASLQALTDEEKRLLASQQ 240
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 156935056  241 QLQQEHLWLTQRTALASALDATRQAAAAADAALQAAAPDLARLEAALPAEKLRPAWLRCQELETALTATGRQYEEVSVRL 320
gi 283784212  241 SAQQQLNWLTRQNELQTQAQHRQQALLAAQSALQQAQPQLAPLSLAQPARALRPLWTRLQEQSAAVSRSQQQINEVKARL 320
gi 296101516  241 NQQRDFQWLTRNDELIREQQRVMLLQQQAQQALTDAAPELAKLQLAQPAAQLRPLWDSQQEQTTRLAQTKQRIVEVNTRL 320
gi 146310526  241 NHQRDFHWLTRHEELQREQQRALTSQQEAQQALTDAAPDLDKLLHAQPAAVLRPLWERQQEQTTRLTQTQQQTQEVNTRL 320
gi 288936895  241 NQQQQLQWLTRCDELAQQHQQAVSRQQQARQALTDAAPALAKLELAQPAAQLRPLWERQQEQVAGLAQTRQRINEVNARL 320
gi 152968911  241 SQQQQLQWLTRRDELAQQQQQAATRQQQARQALADAAPALAKLELAQPAAQLRPLWERQQEQTAGLAQTRQRISEVNARL 320
gi 206578945  241 NQQQQLQWLTRCDELAQQHQQAVSRQQQARQALTDAAPALAKLELAQPAAQLRPLWERQQEQVAGLAQTRQRINEVNARL 320
gi 16759372   241 GQQQHLHWLTRKNELHTELHARQQALYAAQEAREKAQPQLAALTLAQPARQLRPHWERIQEQTRAVERVRQHSDEVNARL 320
gi 161504420  241 TQQQHLHWLTRKNELHAELRARQQSLYEAQEAREKAQPQLAALTLAQPARQLRPHWERIQEQTTAVERVRQQINEVNARL 320
gi 194735358  241 GQQQHLHWLTRKNELHTELHARQQALYAAQEAREKAQPQLAALTLAQPARQLRPHWERIQEQTRAVERVRQHSDEVNARL 320
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 156935056  321 QESQQRRREIRQAAAQQAQAQAAELTQLGQWLTEHDRFRLWSSELAGWRAVLAQQKRDRDQLRALNETLDATRRKRDAMP 400
gi 283784212  321 QSATTLRSRMRRDAQQQTAAMQAARQTLAAWLHEHDRFRVWHSELGGWRALFAQQASDGIQRDRWRQRLAADTQKLAALP 400
gi 296101516  321 QAKAAQRSRIRHTALRTHAQLQSDLTIQATWLAEHERYRVWGQEIAGWRAHFAQLNRDKHQIATLAARIAELRQKLAGMP 400
gi 146310526  321 LSRAALRARIRNGALRTRDRLQTELSALTQWLAGHDRFRLWGQEIAGWRAHFAQLNRDKSQIATLTGRITELRQKLANAP 400
gi 288936895  321 LACTAQRARIRRSALHAQQQRQAELTDLAQWLAAHDRFRLWGQEIAGWRAQFSQLTRDKQQLTAQTTRLAALRQKLSALP 400
gi 152968911  321 LASTALRARIRQGALRAQQQRQAELADLAQWLAAHERFRLWGQEIAGWRAQFSQLTRDKQQLTAQSTRLAALRQKLATLP 400
gi 206578945  321 LACTAQRARIRRSALHAQQQRQAELTDLAQWLAAHDRFRLWGQEIAGWRAQFSQLTRDKQQLTAQTTRLAALRQKLSALP 400
gi 16759372   321 QSAYRLRQRIRACAHRQFTQLNATGQRLKTWLAEHDGIRVWRSELAGWRALLTQQSHDRAQLSQWQQQLLSDMRQRDALP 400
gi 161504420  321 QSAYRLRLRIRACAYRQFTQLDATRQRLKTWLTEHDGIRVWRSELAGWRALLTQQSNERAQLSQWQRQLMSDTRQLDALP 400
gi 194735358  321 QSAYRLRQRIRSCAHRQFTQLNATGQRLKTWLAEHDGIRVWRSELAGWRALLTQQSHDRAQLSQWQQQLLSDTRQRDALP 400
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 156935056  401 DAGLTLSPEDAAQALTKLNEQRPLRQQLATLQSSFAPLTRRKARLQETNSALQTQIQHAEQQLAQKRQDYKTKQEDVARA 480
gi 283784212  401 VLTLNMTPDEVAVALAQHASQRPLRQRLLALHGQIAPRLQRLAQLQEVLAQSRQALAQRTALLEAKRQQYKEKNQHYQDV 480
gi 296101516  401 ENPLTLTADDVAAAMEQQSRSRPLRQRLTSLHARYQPLQKRLQENADTRQKAQSEQVKLNETLTLRRQQYKEKNQHYVDL 480
gi 146310526  401 EIALTLTADEVAAAMDQQTASRASRQQLTTLHARYQPLQKRIVQNAESVQKAQAEQIKLNETLALRRQQYKEKHQHFLDV 480
gi 288936895  401 ASSLSLSAEEVAAAMAQQTQSRPLRQRLLSLHEQHQQLHKRLRQSAENIQQAQTEQAKLNATLTQRREQYKDKNQHYLDL 480
gi 152968911  401 ASPLTLSADDVAAAIEQQTQSRPLRQRLLSLHEQHQLLRKRLRQNAESVQQAQAEQVKLNATLTLRREQYKDKNQHYLDL 480
gi 206578945  401 ASSLSLSAEEVAAAMAQQTQSRPLRQRLLSLHEQHQQLHKRLRQSAENIQQAQTEQAKLNATLTQRREQYKDKNQHYLDL 480
gi 16759372   401 PLTLDLTPQALAEARALHTRQRPLRHRLAALQGQILPKQKRQAQLQAAIARHHQEQTQYTQRLADKRLSYKTKAQELADV 480
gi 161504420  401 PLALDLTPQALAEARALHTQQRPLRQRLAALQGQITPKQKRQAQLQAAITRHQQEQTQYTQHLADKRLSYKAKAQELADV 480
gi 194735358  401 PLTLDLTPQALAEARALHTRQRPLRHRLAALQGQIVPKQKRQAQLQAAIARHHQEQAQYTQRLADKRLSYKTKAQELADV 480
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 156935056  481 KAVCDLEQRIASLVEERARLQPGSPCPLCGATEHPAVEAYQALKPDASRLRLAQLEQEKEQLGTEGAALRGQLDALMKQR 560
gi 283784212  481 KTLCEQEERIKDLESQRALLQSGQPCPLCGSTSHPAVAAYQALELSVNQARRDALEKEVKTLADEGAALRGQCDALRQQL 560
gi 296101516  481 KALCESEATIKKLESYRSQLEAGKPCPLCGSSEHPAIETYQALELTDNQRRRDALEKEVAALKEEGLLVLGQVNALTQQI 560
gi 146310526  481 KALCEREAEIKDLEGYRARLEAGKPCLLCGSTEHPAVEQYQALEITENQRRRDAMEKEVAALKEEGLLVLGQVNALASQI 560
gi 288936895  481 KALCQREETIKDLEGYRARLEAGKPCPLCGSCEHPAIEQYTSLTVTDNQRRRDALEKEVAALKEEGLLVLGQVNALTQQL 560
gi 152968911  481 KALCQREETIKDLESYRDRLEAGKPCPLCGACEHPAIEQYASLTLTDNQRRRDALEKEVAALKEEGLLILGQVKALTQQL 560
gi 206578945  481 KALCQREETIKDLEGYRARLEAGKPCPLCGSCEHPAIEQYASLTVTDNQRRRDALEKEVAALKEEGLLVLGQVNALTQQL 560
gi 16759372   481 RTICEQEARIKDLESQRAHLQSGQPCPLCGSTTHPAIAAYQALELSANQTRRDALEKEVKTLAEEGAALRGQLDALTQQL 560
gi 161504420  481 RTICEQEARIKDLESQRARLQPGQPCPLCGSTTHPAIDAYQALELSANQARRDALEKEVNTLAEEGAALRGQLDALTQQV 560
gi 194735358  481 RTICEQEARIKDLESQRAHLQSGQPCPLCGSTTHPAIAAYQALELSANQTRRDALEKEVKTLAEEGAALRGQLDALTQQL 560
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 156935056  561 QQQESEAASLLEEEQALTSQWQTLCAAAGLTQTPGDDLTPWLDEQTRREQQLHLLRERQMLEATLEGTQRQVTSLEAAWQ 640
gi 283784212  561 QRDESEAQALAKDEQALTVEWQALISNLNITLQPQDDIQPWLTAQEDHEKQLYQLSQRHDLQAQIAAHQQQVTQFSQQIE 640
gi 296101516  561 QRATDEAQTLSQEEQALTKEWQEVCADLNISLNIQEDIAPWMNEQEQYERQLYQLSQRLTLQNQLNEQQAQERQYQQQLS 640
gi 146310526  561 QRDTDEAQTLAQEAQTLTSAWRELCATLNVTLN-IDDIAPWLNEQEQYERQLYQLSQRLVLQSQLNEQEHQERQLQQQIA 639
gi 288936895  561 QRETEAARRLTEEEQALTKAWQETCAALQVTRDIAQEINDWMQEQERYEQQLYQLSQRLMLQSQLNDQQALERQAHQQLE 640
gi 152968911  561 QRDTEAAGRLAEEEQALTKAWQETCASLHIARDIAQEINDWMQEQERYEQQLYQLSQRLMLQSQLNDQQALERQAEQQLA 640
gi 206578945  561 QRETEADRRLTEEEQALTKAWQETCAALQVTRDIAQEINDWMQEQERYEQQLYQLSQRLMLQSQLNDQQALERQAHQQLE 640
gi 16759372   561 QRDESEAQSLLQEEQALTEEWQTLCATLGVQLQPQEDLAGWLTAAEEHEQQLDQLSQRHALQTQIAAHTEQVARFTAQIA 640
gi 161504420  561 QRDESEARSLLLEEQALTEEWQTLCAALNVQLQPQEDLSGWLTGAEEHEQQLDQLSQRHALQTQIAAHTEQVARFTAQIA 640
gi 194735358  561 QRDESEAQSLLQEEQALTEEWQTLCATLGVQLQPQEDLAGWLTAAEEHEQQLDQLSQRHALQTQIAAHTEQVARFTAQIA 640
                         650       660       670       680       690       700       710       720
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 156935056  641 TQQAALRDQLDAFALPAPDNDNPAPWFAEREEEARRWQQNHERQQRLREQLAACEALLTLLPQEGD--AQAASLAADDLp 718
gi 283784212  641 QRQATLTAQLSHYALSLPEEGAEETWLSDRAAEAQTWQQKQDELNELQSRIAQLAPLLDTLPATDAaaEDGAPVALDNW- 719
gi 296101516  641 ATRQALENALLALSLHVPEEGEETAWLYARETEFNLWQEKQTQYAAIQERINTLKPLLDTLPAGDD--TEAEPAIPENW- 717
gi 146310526  640 TTRLTLENALNALSLKVPDEGAETLWLTERESESSHWQAQQNQLTALQERINALTPLLDTLPATDT--EDAESVIPDNW- 716
gi 288936895  641 TTRQGLENALQTLSLSLPEEGAEAAWLHARESEFARWQAQQTRHGVLQEQIAALKPLLDTLPPGDEddAEAEPVIPDNW- 719
gi 152968911  641 ATRQGLESALQALALSLPAEGTEAAWLHARESEFAQWQAQQTQHDAIQQQIAALRPLLETLPTSDEteVEAESAIPDNW- 719
gi 206578945  641 TTRQGLENALQTLSLSLPEEGAEAAWLHARESEFARWQAQQTRHGALQEQIAALKPLLDTLPPGDEddAEAEPVIPDNW- 719
gi 16759372   641 QRQASLTADLAQYTLSLPAPEDEASWLNERADEAKIWQQRQTEFADLQTQIDRLAPLLETLPQTDTa-DSDDDVPLDNW- 718
gi 161504420  641 QRQASLTADLALYKLSLPAPEDEATWLSDRADEAKMWQQRQTELADLQTQLDRLAPLLETLPQMGTv-DVDDDVPLDNW- 718
gi 194735358  641 QRQASLTADLAQYTLSLPAPENEASWLNERADEAKIWQQRQTEFADLQTQIDRLAPLLETLPQTDTa-DSDDDVPLDNW- 718
                         730       740       750       760       770       780       790       800
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 156935056  719 ragQEIHTRCLSLEAQWQTLGAQLLQERARYQSALQAFEAALAASPFADKAAFLAALLDDAARSQLEAQKQRLERERETQ 798
gi 283784212  720 ---RQVHDDCLSLQSQLQTLQQQAVLEQQRASDAQAQFAAALESSIFADQSAFLAALLDDEAIARLEQLSQTLESQIQQA 796
gi 296101516  718 ---REIHDECLSLQSQLATLQQQESLESERLQHATAQFATALAASCFADREAFLAALLDEETIHRLEQRKQTLESQLQQA 794
gi 146310526  717 ---REIHNECVSLQSQLATLQQQESLETERMQQAQAQFAAALAGSAFPDCDAFLRALLDADTMQRLETLKQTLENRIQQA 793
gi 288936895  720 ---REIHEECLSLHSQLVAQQQLETEETARVHQSQTQFTTALAASRFNDLEAFLAALLDDETAQRLTQLKQSLEQQLQQA 796
gi 152968911  720 ---REIHEECLSLHSQLVAQQQQETQEKARLDQSQAQFTSALAASRFSDREAFLAALLDDETAQRLTQLKQTLEQQLQQA 796
gi 206578945  720 ---REIHEECLSLHSQLGAQQQLETEETARVHQSQTQFTTALAASRFNDREAFLAALLDDETAQRLTQLKQSLEQQLQQA 796
gi 16759372   719 ---RQTHDECVSLQSQLQTLQEQTTQEQQRAAEAIAHFDAALKNSPFDSQATFLAALLDEETVTRLEKQQQTLESQLQQA 795
gi 161504420  719 ---RQAHDECVSLQSQLQTLQQQATQEQQRATEATVHFDAALKNSPFDSQTAFLAALLDEETLTCLEKQQQALESQLQQA 795
gi 194735358  719 ---RQAHDECVSLQSQLQTLQEQTTQEQQRATEAIAHFDAALKNSPFDRQATFLAALLDEETVTRLEKQQQTLESQLQQA 795
                         810       820       830       840       850       860       870       880
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 156935056  799 HTLLAQAQQALERHLSARPESLEEQADAQQSEAALAAVTEQLRDNTTRQGELRQQLRQDEESRTQLAALLGQIDEARREA 878
gi 283784212  797 QTLATQSAQALAAHQQQPPGFLDCALSVEEIAQALTLLNQQLRDNASRQGEIRQQLKQDADNRQQQQSLMRQIDSASQQV 876
gi 296101516  795 IALSGQAEQQLQAHQHQQPEGLD--ADAQTLHVQLQQLAQQLRENTTHQGEIRQQLKQDSDNRQHQLALMQQIDEASRLA 872
gi 146310526  794 TALVRQANQLLSEHLAQRPEGLQ--SDVPTLQLELQQLAQRLRENSTRQGEISQQLRQDGENRQQQQALIQQIDEAARLA 871
gi 288936895  797 TVLCEQATQQQQAHLALRPQGSD--ADGPTLQTQLHALAQRLRDNTTRQGEIRQQLRQDNESRQQQQALGQQIAEAAQLA 874
gi 152968911  797 AALCEQATRQHEAHLALRPQGVD--ADVPTLQTQLHALAQRLRDNTTRQGEIRQQLRQDAESRQQQQALGQQIAEAAQLA 874
gi 206578945  797 TVLCEQATQQQQAHLALRPQGSD--ADGPTLQTQLHALAQRLRDNTTRQGEIRQQLRQDNESRQQQQALGQQIAEAAQLA 874
gi 16759372   796 KALSAQSAQALADHQQQPPAGLDPTCTAEQLAQRLAQLAQQLRENTTRQGEIRQQIKQDADNRQRQRALMAEMKQASQQV 875
gi 161504420  796 KALSVQSAQTLADHQQQSPDGLNPTCTAEQLSQKLTQLAQQLRENTTRQGEIRQQIKQDADNRQHQRALMAEIAKASLEV 875
gi 194735358  796 KALSAQSAQALADHQQQPPAGLDPTCTAEQLAQRLAQLAQQLRENTTRQGEIRQQIKQDADNRQRQRALMAEMKQASQQV 875
                         890       900       910       920       930       940       950       960
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 156935056  879 DEWGQLNHLVGSQKGDKFRKFAQGLTLDNLVWLANNQLTRLHGRYLLKRKLSEDLELEVVDTWQADAVRDTRTLSGGESF 958
gi 283784212  877 DDWGYLNTLIGSKEGDKFRKFAQGLTLDNLVWLANNQLTRLHGRYLLQRKVSNALELEVVDTWQADAVRDTRTLSGGESF 956
gi 296101516  873 EDWGYLNALIGSSTGDKFRKFAQGLTLDNLVWLANQQLNRLHGRYLLQRKVSDALELEVVDTWQADAVRDTRTLSGGESF 952
gi 146310526  872 DDWGYLNALIGSSTGDRFRKFAQGLTLDNLVWLANQQLNRLHGRYLLQRKASDALELEVVDTWQADAVRDTRTLSGGESF 951
gi 288936895  875 DDWGYLNSLIGSSTGDRFRKFAQGLTLDNLVWLANQQLNRLHGRYLLQRKASEALELEVVDTWQADAVRDTRTLSGGESF 954
gi 152968911  875 DDWGYLNSLIGSSTGDRFRKFAQGLTLDNLVWLANQQLNRLHGRYLLQRKASEALELEVVDTWQADAVRDTRTLSGGESF 954
gi 206578945  875 DDWGYLNSLIGSSTGDRFRKFAQGLTLDNLVWLANQQLNRLHGRYLLQRKASEALELEVVDTWQADAVRDTRTLSGGESF 954
gi 16759372   876 EDWGYLNALIGSKEGDKFRKFAQGLTLDNLVWLANHQLTRLHGRYLLQRKASDALELEVVDTWQADAVRDTRTLSGGESF 955
gi 161504420  876 EDWGYLNALIGSKEGDKFRKFAQGLTLDNLVWLANHQLTRLHGRYLLQRKASDALELEVVDTWLADAVRDTRTLSGGESF 955
gi 194735358  876 EDWGYLNALIGSKEGDKFRKFAQGLTLDNLVWLANHQLTRLHGRYLLQRKASDALELEVVDTWQADAVRDTRTLSGGESF 955
                         970       980       990      1000      1010      1020      1030      1040
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 156935056  959 LVSLALALALSDLVSHKTRIDSLFLDEGFGTLDAQTLDTALDALDALNASGKTIGVISHVEAMKERIPVQIKVRKINGLG 1038
gi 283784212  957 LVSLALALALSDLVSHKTRIDSLFLDEGFGTLDSETLDTALDALDALNASGKTIGVISHVEAMKERIPVQIKVKKINGLG 1036
gi 296101516  953 LVSLALALALSDLVSHKTRIDSLFLDEGFGTLDSETLDTALDALDALNATGKTIGVISHVEAMKERIPVQIKVKKINGLG 1032
gi 146310526  952 LVSLALALALSDLVSHKTRIDSLFLDEGFGTLDSETLDTALDALDALNATGKTIGVISHVEAMKERIPVQIKVKKINGLG 1031
gi 288936895  955 LVSLALALALSDLVSHKTRIDSLFLDEGFGTLDSETLDTALDALDALNASGKIIGVISHVEAMKERIPVQIKVKKINGLG 1034
gi 152968911  955 LVSLALALALSDLVSHKTRIDSLFLDEGFGTLDSETLDTALDALDALNASGKIIGVISHVEAMKDRIPVQIKVKKINGLG 1034
gi 206578945  955 LVSLALALALSDLVSHKTRIDSLFLDEGFGTLDSETLDTALDALDALNASGKIIGVISHVEAMKERIPVQIKVKKINGLG 1034
gi 16759372   956 LVS--LALALSDLVSHKTRIDSLFLDEGFGTLDSETLDAALDALDALNASGKTIGVISHVEAMKERIPVQIKVKK----- 1028
gi 161504420  956 LVSLALALALSDLVSHKTRIDSLFLDEGFGTLDSETLDAALDALDALNASGKTIGVISHVEAMKERIPVQIKVKKINGLG 1035
gi 194735358  956 LVSLALALALSDLVSHKTRIDSLFLDEGFGTLDSETLDAALDALDALNASGKTIGVISHVEAMKERIPVQIKVKKINGLG 1035
                        1050
                  ....*....|.
gi 156935056 1039 VSRLAREYQVD 1049
gi 283784212 1037 YSKLDRIFAVA 1047
gi 296101516 1033 YSRLDKEFAVQ 1043
gi 146310526 1032 YSKLDKVFAVE 1042
gi 288936895 1035 YSRLDRVFAVE 1045
gi 152968911 1035 YSRLDKAFAVE 1045
gi 206578945 1035 YSRLDRVFAVE 1045
gi 16759372  1029 -----NQWAWL 1034
gi 161504420 1036 YSKLDKMFAVE 1046
gi 194735358 1036 YSKLDKAFAVE 1046
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap