Conserved Protein Domain Family
PRK09863

?
PRK09863: PRK09863 
putative frv operon regulatory protein; Provisional
Links
?
Statistics
?
PSSM-Id: 182121
View PSSM: PRK09863
Aligned: 29 rows
Threshold Bit Score: 802.532
Threshold Setting Gi: 28379830
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28379830    1 MLNSRELRIILLLQEHDLSGEDLAALLETSRRTVVRDIARINGLLRSESIGSIESVKKYHLLVLNRANLNRLLTQSNHES 80
gi 253775465   1 MLNERQLKIVDLLEQQPRTPGELAQQTGVSGRTILRDIDYLNFTLNGKARIFASGSAGYQLEIFERRSFFQLLQKHDNDD 80
gi 254163847   1 MLNERQLKIVDLLEQQPRTPGELAQQTGVSGRTILRDIDYLNFTLNGKARIFASGSAGYQLEIFERRSFFQLLQKHDNDD 80
gi 260857701   1 MLNERQLKIVDLLEQQPRTPGELAQQTGVSGRTILRDIDYLNFTLNGKARISASGSAGYQLEIFERRSFFQLLQKHDNDD 80
gi 260870616   1 MLNERQLKIVDLLEQQPRTPGELAQQTGVSGRTILRDIDYLNFTLNGKARISASGSAGYQLEIFERRSFFQLLQKHDNDD 80
gi 157163369   1 MLNERQLKIVDLLEQQPRTPGELAQQTGVSGRTILRDIDYLNFTLNGKARIFASGSAGYQLEIFERRSFFQLLQKHDNDD 80
gi 258538654   1 MLLLREIKVLRRLSQQDFSGGELAKQLKASRRTIVRDIAAINTELQSSGIGMITTQNKYHLTILNPGRLMALLDTSRDEA 80
gi 218697612   1 MLNERQLKIVDLLEQQPRTPGELAQQTGVSGRTILRDIDYLNFTLNGKARIFASGSAGYQLEIFERRSFFQLLQKHDNDD 80
gi 254557971   1 MLNSRELRIILLLQEHDLSGEDLAALLETSRRTVVRDIARINGLLRSESIGSIESVKKYHLLVLNRANLNRLLTQSNHES 80
gi 260846682   1 MLNERQLKIVDLLEQQPRTPGELAQQTGVSGRTILRDIDYLNFTLNGKARISASGSAGYQLEIFERRSFFQLLQKHDNDD 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28379830   81 VLVLLnLLVSPNITMGELIERTFMSRQSIMNCIEKINRQYAKILKIRLRPRIGISVSVNHISKIDILAALISDDHQLVEK 160
gi 253775465  81 RLLAL-LLLNTFTPRAQLASALNLPETWVAERLPRLKQRYERTCCLASRPGLGHFIDETEEKRVILLANLLRKDPFLIPL 159
gi 254163847  81 RLLAL-LLLNTFTPRAQLASALNLPETWVAERLPRLKQRYERTCCLASRPGLGHFIDETEEKRVILLANLLRKDPFLIPL 159
gi 260857701  81 RLLAL-LLLNTFTPRAQLASALNLPETWVAERLPRLKQRYERTCCLASRPGLGHFIDETEEKRVILLANLLRKDPFLIPL 159
gi 260870616  81 RLLAL-LLLNTFTPRAQLASALNLPETWVAERLPRLKQRYERTCCLASRPGLGHFIDETEEKRVILLANLLRKDPFLIPL 159
gi 157163369  81 RLLAL-LLLNTFTPRAQLASALNLPETWVAERLPRLKQRYERTCCLASRPGLGHFIDETEEKRVILLANLLRKDPFLIPL 159
gi 258538654  81 NEILLrLCISETIPMADLIAETYLSRTQIMDYISELNADYADIFRISSRPGMGMTIKMKRLTRIDIAADCIFEYPQLLDK 160
gi 218697612  81 RLLAL-LLLNTFTPRAQLASALNLPETWVAERLPRLKQRYERTCCLASRPGLGHFIDETEEKRVILLANLLRKDPFLIPL 159
gi 254557971  81 VLVLLnLLVSPNITMGELIERTFMSRQSIMNCIEKINRQYAKILKIRLRPRIGIFVSVNHISKIDILAALISDDHQLVEK 160
gi 260846682  81 RLLAL-LLLNTFTPRAQLASALNLPETWVAERLPRLKQRYERTCCLASRPGLGHFIDETEEKRVILLANLLRKDPFLIPL 159
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28379830  161 RFKLINQSEDLArIRMIVKQQIP--EKMFDYLTDSQLSAQIMACTLiSKDNTVIMKSTLYKVLLKSGV--PHLQSATLAV 236
gi 253775465 160 AGITRDNLQHLS-TACDNQHRWP--LMQGDYLSSLILAIYALRNQL-TDEWPQYPGDEIKQIVEHSGLflGDNAVRTLTG 235
gi 254163847 160 AGITRDNLQHLS-TACDNQHRWP--LMQGDYLSSLILAIYALRNQL-TDEWPQYPGDEIKQIVEHSGLflGDNAVRTLTG 235
gi 260857701 160 AGVTRDNLQHLS-TACDNQHRWP--LMQGDYLSSLILAIYALRNQL-TDEWPQYPGDEIKQIVEHSGLflGDNAVRTLTG 235
gi 260870616 160 AGVTRDNLQHLS-TACDNQHRWP--LMQGDYLSSLILAIYALRNQL-TDEWPQYPGDEIKQIVEHSGLflGDNAVRTLTG 235
gi 157163369 160 AGITRDNLQHLS-TACDNQHRWP--LMQGDYLSSLILAIYALRNQL-TDEWPQYPGDEIKQIVEQSGMflGDNAVRTLTG 235
gi 258538654 161 VAPGTDRLPQLTdYLSENICPYQtwVIDSQWRAQVLAAFICSPS---------------------SGTltAARQSNQIDN 219
gi 218697612 160 AGITRDNLQHLS-TACDNQHRWP--LMQGDYLSSLILAIYALRNQL-TDEWPQYPGDEIKQIVEHSGLflGYNAVRTLTG 235
gi 254557971 161 RFKLINQSEDLArIRMIVKQQIP--EKMFDYLTDSQLSAQIMACTLiSKDNTVIMKSTLYKVLLKSGV--PHLQSATLAV 236
gi 260846682 160 AGVTRDNLQHLS-TACDNQHRWP--LMQGDYLSSLILAIYALRNQL-TDEWPQYPGDEIKQIVEHSGLflGDNAVRTLTG 235
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28379830  237 FFDAKKQLLNHMTI--RQVQLAVRATRSRYTLAAFNHSFVNEIFKHLCRSAMFPTIAPASLSEQISYLKVQNPFAFDFAF 314
gi 253775465 236 LIEKQHQQAQVISA--DNVQGLLQRVPGIASLNIIDAQLVENITGHLLRCLAAPVWIAEHRQSSMNNLKAAWPAAFDMSL 313
gi 254163847 236 LIEKQHQQAQVISA--DNVQGLLQRVPGIASLNIIDAQLVENITGHLLRCLAAPVWIAEHRQSSMNNLKAAWPAAFDMSL 313
gi 260857701 236 LIEKQHQQAQIISA--DNVQRLLQRVPGIASLNIIDTQLVENITGHLLRCLAAPVWIAEHRQSSMNNLKAAWPAAFDMSL 313
gi 260870616 236 LIEKQHQQAQIISA--DNVQRLLQRVPGIASLNIIDTQLVENITGHLLRCLAAPVWIAEHRQSSMNNLKAAWPAAFDMSL 313
gi 157163369 236 LIEKQHQQAQIISA--DNVQRLLQRVPGIASLNIIDTRLVENITGHLLRCLAAPVWIAEHRQSSMNNLKAAWPAAFDMSL 313
gi 258538654 220 FVKTREALLMGLGKsrDKIVQMFSEIADDFQLEAIGQSTFESLFTHFVRECAFPRPLSVLSDYDIAKLSAQNPVAFDYAH 299
gi 218697612 236 LIEKQHQQAQIISA--DNVQRLLQRVPGIASLNIIDTQLVENITGHLLRCLAAPVWIAEHRQSSMNNLKAAWPAAFDMSL 313
gi 254557971 237 FFDAKKQLLNHMTI--RQVQLAVRATRSRYTLAAFNHSFVNEIFKHLCRSAMFPTIAPASLSEQISYLKVQNPFAFDFAF 314
gi 260846682 236 LIEKQHQQAQIISA--DNVQRLLQRVPGIASLNIIDTQLVENITGHLLRCLAAPVWIAEHRQSSMNNLKAAWPAAFDMSL 313
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28379830  315 DLSKKLQQCFESVQIDDEYIALYVLHAIESPTARNVRTLMYATQQSVANINKMIITQKISNIDIEMVFSKEQLESRLNYI 394
gi 253775465 314 HFITLLREQLDIPLFDSDLIGLYFACALERHQNERQPIILLSDQNAIATINQLAIERDVLHCRVIIARSLSELVAIREEI 393
gi 254163847 314 HFITLLREQLDIPLFDSDLIGLYFACALERHQNERQPIILLSDQNAIATINQLAIERDVLHCRVIIARSLSELVAIREEI 393
gi 260857701 314 HFITLLREQLDIPLFDSDLIGLYFACALERHQNERQPIILLSDQNAIATINQLAIERDVLHCRVIIARSLSELVAIREEI 393
gi 260870616 314 HFITLLREQLDIPLFDSDLIGLYFACALERHQNERQPIILLSDQNAIATINQLAIERDVLHCRVIIARSLSELVAIREEI 393
gi 157163369 314 HFITLLREQLDIPLFDSDLLGLYFACALERHQNERQPIILLSDQNAIATINQLAIERDVLNCRVIIARSLSELVAIREEI 393
gi 258538654 300 VVALDLFKISHQVWLDSDFLALYIVQAVNQREAKPVRILFLAPRMSLAQINATIIQQKLHNISLHMVRSLKEAETIFDQR 379
gi 218697612 314 HFITLLREQLDIPLFDSDLIGLYFACALERHQNERQPIILLSDQNAIATINQLAIERDVLHCRVIIARSLSELVAIREEI 393
gi 254557971 315 DLSKKLQQCFESVQIDDEYIALYVLHAIESPTARNVRTLMYATQQSVANINKMIITQKISNIDIEMVFSKEQLESRLNYI 394
gi 260846682 314 HFITLLREQLDIPLFDSDLIGLYFACALERHQNERQPIILLSDQNAIATINQLAIERDVLHCRVIIARSLSELVAIREEI 393
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28379830  395 NYNLVIGNGVHPndLQLPINFDSTFNGVISLDELEHLKSLSSESYIQKNLSSFLPKSHFYHAPT-----KYINVNQTLKA 469
gi 253775465 394 EPLLIINNSHYL--LDDAVNNYITVKNIITAAGIEQIKHFLATAFIRQQPERFFSAPGSFHYSNvr-geSWQHITRQICA 470
gi 254163847 394 EPLLIINNSHYL--LDDAVNNYITVKNIITAAGIEQIKHFLATAFIRQQPERFFSAPGSFHYSNvr-geSWQHITRQICA 470
gi 260857701 394 EPLLIINNSHYL--LDDAVNNYITVKNIITAAGIEQIKHFLATAFIRQQPERFFSAPGSFHYSNvr-geSWQHITRQICA 470
gi 260870616 394 EPLLIINNSHYL--LDDAVNNYITVKNIITAAGIEQIKHFLATAFIRQQPERFFSAPGSFHYSNvr-geSWQHITRQICA 470
gi 157163369 394 EPLLIINNSHYL--LDDAVNNYITVKNIITAAGIEQIKHFLATAFIRQQPERFFSAPGSFHYSNvr-geSWQHITRQICA 470
gi 258538654 380 HFDLAIANVRHDvvEHASISFVLTFSAVVTDQDIAALEQLVNGQYYRENIAAMLAPN---HFVGqitgdKFLTVLQKGLQ 456
gi 218697612 394 EPLLIINNSHYL--LDDAVNNYITVKNIITAAGIEQIKHFLATAFIRQQPERFFSAPGSFHYSNvr-geSWQHITRQICA 470
gi 254557971 395 NYNLVIGNGVHPndLQLPINFDSTFNGVISLDELEHLKSLSSESYIQKNLSSFLPKSHFYHAPTk-----YINVNQTLKA 469
gi 260846682 394 EPLLIINNSHYL--LDDAVNNYITVKNIITAAGIEQIKHFLATAFIRQQPERFFSAPGSFHYSNvr-geSWQHITRQICA 470
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28379830  470 GLtnfAEQGLLTNDQSKALLAR--EAAGNQLVLNHVSLPHASTELSDAYKVFAITFDGIMKIDGNPIYLILIVLANEKRA 547
gi 253775465 471 QL---VAQHHITADEAQRIIAR--EGEGENLIVNRLAIPHCWSEQERRFRGFFITLAQPVEVNNEVINHVLIACAAADAR 545
gi 254163847 471 QL---VAQHHITADEAQRIIAR--EGEGENLIVNRLAIPHCWSEQERRFRGFFITLAQPVEVNNEVINHVLIACAAADAR 545
gi 260857701 471 QL---VAQHHITADEAQRIIAR--EGEGENLIVNRLAIPHCWSEQERRFRGFFITLAQPVEVNNEVINHVLIACAAADAR 545
gi 260870616 471 QL---VAQHHITADEAQRIIAR--EGEGENLIVNRLAIPHCWSEQERRFRGFFITLAQPVEVNNEVINHVLIACAAADAR 545
gi 157163369 471 QL---VAQHHITADEAQRIIARegEGEGENLIVNRLAIPHCWSEQERRFRGFFITLAQPVEVNNEVINHVLIACAAADAR 547
gi 258538654 457 NF---VRNDLLDRADAVKIIER--EQAGNQLVLNHISIPHIVTNSVTDYRLFAIKPKEVITIDDQPIYLLVIVLVGTSQA 531
gi 218697612 471 QL---VAQHHITADEAQRIIAR--EGEGENLIVNRLAIPHCWSEQERRFRGFFITLAQPVEVNNEVINHVLIACAAADAR 545
gi 254557971 470 GLtnfAEQGLLTNDQSKALLAR--EAAGNQLVLNHVSLPHASTELSDAYKVFAITFDGIMKIDGNPIYLILIVLANEKRA 547
gi 260846682 471 QL---VAQHHITADEAQRIIAR--EGEGENLIVNRLAIPHCWSEQERRFRGFFITLAQPVEVNNEVINHVLIACAAADAR 545
                        570       580       590
                 ....*....|....*....|....*....|....*
gi 28379830  548 DSGQVFSYLYTRLKQLSNVQLQNVDTYETLIKYLK 582
gi 253775465 546 HELKIFSYLASVLCQHPAEVIAGLTGYEAFMELLH 580
gi 254163847 546 HELKIFSYLASVLCQHPAEVIAGLTGYEAFMELLH 580
gi 260857701 546 HELKIFSYLASILCQHPAEIIAGLTGYEAFMELLH 580
gi 260870616 546 HELKIFSYLASILCQHPAEIIAGLTGYEAFMELLH 580
gi 157163369 548 HELKIFSYLASILCQHPAEIIAGLTGYEAFMELLH 582
gi 258538654 532 EKNTIFSYLYQTLRRYVPADIEDVQDYQQVIKLLK 566
gi 218697612 546 HELKIFSYLASVLCQHPAEVIAGLTGYEAFMELLH 580
gi 254557971 548 DSGQVFSYLYTRLKQLSNVQLQNVDTYETLIKYLK 582
gi 260846682 546 HELKIFSYLASVLCQHPAEVIAGLTGYEAFMELLH 580
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap