Conserved Protein Domain Family
PRK09862

?
PRK09862: PRK09862 
putative ATP-dependent protease; Provisional
Statistics
?
PSSM-Id: 182120
View PSSM: PRK09862
Aligned: 45 rows
Threshold Bit Score: 1012.59
Threshold Setting Gi: 296105340
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
15804357   11 MSLSIVHTRAALGVNAPPITVEVHISKGLPGLTMVGLPETTVKEARDRVRSAIINSGYEYPAKKITINLAPADLPKEGGR 90 
62182376    1 MSLAIVHTRAALGVNAPPITIEVHISNGLPGLTMVGLPETTVKEARDRVRSAIINSGYEFPAKKITINLAPADLPKEGGR 80 
205354528   1 MSLAIVHTRAALGVNAPPITIEVHISNGLPGLTMVGLPETTVKEARDRVRSAIINSGYEFPAKKITINLAPADLPKEGGR 80 
296105340   1 MSLSVVYTRAAIGVKAPLISVEVHLSNGLPGLTLVGLPETTVKEARDRVRSAIINSGYTFPAKKITINLAPADLPKEGGR 80 
161617016   1 MSLAIVHTRAALGVNAPPITIEVHISNGLPGLTMVGLPETTVKEARDRVRSAIINSGYEFPAKKITINLAPADLPKEGGR 80 
197250076   1 MSLAIVHTRAALGVNAPPITIEVHISNGLPGLTMVGLPETTVKEARDRVRSAIINSGYEFPAKKITINLAPADLPKEGGR 80 
198242242   1 MSLAIVHTRAALGVNAPPITIEVHISNGLPGLTMVGLPETTVKEARDRVRSAIINSGYEFPAKKITINLAPADLPKEGGR 80 
194445964   1 MSLAIVHTRAALGVNAPPITIEVHISNGLPGLTMVGLPETTVKEARDRVRSAIINSGYEFPAKKITINLAPADLPKEGGR 80 
161505582  33 MSLSIVHTRAALGVNAPPITIEVHISNGLPGLTMVGLPETTVKEARDRVRSAIINSGYEFPAKKITINLAPADLPKEGGR 112
194448893   1 MSLAIVHTRAALGVNAPPITIEVHISNGLPGLTMVGLPETTVKEARDRVRSAIINSGYEFPAKKITINLAPADLPKEGGR 80 
15804357   91 YDLPIAIALLAASEQLTANKLDEYELVGELALTGALRGVPGAISSATEAIKSGRKIIVAKDNEDEVGLINGEGCLVADHL 170
62182376   81 YDLPIAVALLAASEQLTASNLEAYELVGELALTGALRGVPGAISSATEAIRAGRNIIVATENAAEVGLISKEGCFIADHL 160
205354528  81 YDLPIAVALLTASEQLTASNLEAYELVGELALTGALRGVPGAISSATEAIRAGRNIIVATENAAEVGLISKEGCFIADHL 160
296105340  81 YDLPIAIALLAASEQLNTARLGSYEFIGELALTGALRGVPGAISGALEAIHAGRQIIVANENASEVSLIAEKGCLVAGHL 160
161617016  81 YDLPIAVALLAASEQLTASNLEAYELVGELALTGALRGVPGAISSATEAIRAGRNIIVATENAAEVGLISKEGCFIADHL 160
197250076  81 YDLPIAVALLAASEQLTASNLEAYELVGELALTGALRGVPGAISSATEAIRAGRNIIVATENAAEVGLISKEGCFIADHL 160
198242242  81 YDLPIAVALLAASEQLTASNLEAYELVGELALTGALRGVPGAISSATEAIRAGRNIIVATENAAEVGLISKEGCFIADHL 160
194445964  81 YDLPIAVALLAASEQLTESNLEAYELVGELALTGALRGVPGAISSATEAIRAGRNIIVATENAAEVGLISKEGCFIADHL 160
161505582 113 YDLPIAVALLAASEQLTASNLEAYELVGELALTGALRGVPGAISSATEAIRAGRNIIVATENAAEVGLISREGCFIADHL 192
194448893  81 YDLPIAVALLAASEQLTASNLEAYELVGELALTGALRGVPGAISSATEAIKAGRNIIVATENAAEVGLISKEGCFIADHL 160
15804357  171 QAVCAFLEGKHALERPKPTDAVSRALQHDLSDVVGQEQGKRGLEITAAGGHNLLLIGPPGTGKTMLASRINGLLPDLSNE 250
62182376  161 QTVCAFLEGKHALERPLAQDMASPTATADLRDVIGQEQGKRGLEITAAGGHNLLLIGPPGTGKTMLASRLSGILPPLSNE 240
205354528 161 QTVCAFLEGKHALERPLAQDMASSTATADLRDVIGQEQGKRGLEITAAGGHNLLLIGPPGTGKTMLASRLSGILPPLSNE 240
296105340 161 QEVCAHLEGRHTLSEPEETGDILPESPDDLSDIIGQEQGKRALEITAAGGHNLLLIGPPGTGKTMLASRLSGLLPPLNNH 240
161617016 161 QTVCAFLEGKHALERPLAQDMASPTATADLRDVIGQEQGKRGLEITAAGGHNLLLIGPPGTGKTMLASRLSGILPPLSNE 240
197250076 161 QTVCAFLEGKHALERPLAQNMASSTATADLRDVIGQEQGKRGLEITAAGGHNLLLIGPPGTGKTMLASRLSGILPPLSNE 240
198242242 161 QTVCAFLEGKHALERPLAQDMASSTATADLRDVIGQEQGKRGLEITAAGGHNLLLIGPPGTGKTMLASRLSGILPPLSNE 240
194445964 161 QTVCAFLEGKHALERPLAQDMASPTATADLRDVIGQEQGKRGLEITAAGGHNLLLIGPPGTGKTMLASRLSGILPPLSNE 240
161505582 193 QTVCAFLEGKHALERPLAQDMVSPITTADLSDVIGQEQGKRGLEITAAGGHNLLLIGPPGTGKTMLASRLSGILPPLSNE 272
194448893 161 QTVCAFLEGKHALERPLAQDMASPTATADLRDVIGQEQGKRGLEITAAGGHNLLLIGPPGTGKTMLASRLSGILPPLSNE 240
15804357  251 EALESAAILSLVNAESVQKQWRQRPFRSPHHSASLTAMVGGGAIPGPGEISLAHNGVLFLDELPEFERRTLDALREPIES 330
62182376  241 EALESAAILSLVNADTVQKRWQQRPFRSPHHSASLTAMVGGGAIPAPGEISLAHNGILFLDELPEFERRTLDALREPIES 320
205354528 241 EALESAAILSLVNADTVQKRWQQRPFRSPHHSASLTAMVGGGAIPAPGEISLAHNGILFLDELPEFERRTLDALREPIES 320
296105340 241 EALESAAIFSLVSSASLQKQWRRRPFRSPHHSASLTAMVGGGSIPGPGEISLAHNGILFLDELPEFERRVLDALREPIES 320
161617016 241 EALESAAILSLVNADTVQKRWQQRPFRSPHHSASLTAMVGGGAIPAPGEISLAHNGILFLDELPEFERRTLDALREPIES 320
197250076 241 EALESAAILSLVNADTVQKRWQQRPFRSPHHSASLTAMVGGGAIPAPGEISLAHNGILFLDELPEFERRTLDALREPIES 320
198242242 241 EALESAAILSLVNADTVQKRWQQRPFRSPHHSASLTAMVGGGAIPAPGEISLAHNGILFLDELPEFERRTLDALREPIES 320
194445964 241 EALESAAILSLVNADTVQKRWQQRPFRSPHHSASLTAMVGGGAIPAPGEISLAHNGILFLDELPEFERRTLDALREPIES 320
161505582 273 EALESAAILSLVNADTVQKRWQQRPFRSPHHSASLTAMVGGGAIPAPGEISLAHNGILFLDELPEFERRTLDALREPIES 352
194448893 241 EALESAAILSLVNADTVQKRWQQRPFRSPHHSASLTAMVGGGAIPAPGEISLAHNGILFLDELPEFERRTLDALREPIES 320
15804357  331 GQIHLSRTRAKITYPARFQLVAAMNPSPTGHYQGNHNRCTPEQTLRYLNRLSGPFLDRFDLSLEIPLPPPGILSKTVVPG 410
62182376  321 GQIHLSRTRAKITYPARFQLIAAMNPSPTGHYQGNHNRCTPEQTLRYLNRLSGPFLDRFDLSLEVPLPPPGILSQHASKG 400
205354528 321 GQIHLSRTRAKITYPARFQLIAAMNPSPTGHYQGNHNRCTPEQTIRYLNRLSGPFLDRFDLSLEIPLPPPGILSQHASKG 400
296105340 321 GEIHISRTRAKISYPAQFQLVAAMNPSPSGHYQGNHNRCTPEQTLRYLGKLSGPFLDRFDLSLEIPLPPPGLLSQTTIRG 400
161617016 321 GQIHLSRTRAKITYPARFQLIAAMNPSPTGHYQGNHNRCTPEQTLRYLNRLSGPFLDRFDLSLEIPLPPPGILSQHASKG 400
197250076 321 GQIHLSRTRAKITYPARFQLIAAMNPSPTGHYQGNHNRCTPEQTLRYLNRLSGPFLDRFDLSLEIPLPPPGILSQHASKG 400
198242242 321 GQIHLSRTRAKITYPARFQLIAAMNPSPTGHYQGNHNRCTPEQTLRYLNRLSGPFLDRFDLSLEIPLPPPGILSQHASKG 400
194445964 321 GQIHLSRTRAKITYPARFQLIAAMNPSPTGHYQGNHNRCTPEQTLRYLNRLSGPFLDRFDLSLEVPLPPPGILSQHASKG 400
161505582 353 GQIHLSRTRAKITYPARFQLIAAMNPSPTGHYQGNHNRCTPEQTLRYLSKLSGPFLDRFDLSLEIPLPPPGILSQHASKG 432
194448893 321 GQIHLSRTRAKITYPARFQLIAAMNPSPTGHYQGNHNRCTPEQTLRYLNRLSGPFLDRFDLSLEIPLPPPGILSQHASKG 400
15804357  411 ESSTTVKQRVMAARERQFKRQNKLNAWLDSPEIRKFCKLESEDAQWLEETLIHLGLSIRAWQRLLKVARTIADIDQSDII 490
62182376  401 ESSATVKKRVIAAHERQYRRQKKLNARLEGREIQKYCVLHHDDARWLEDTLVHLGLSIRAWQRLLKVARTIADIELADQI 480
205354528 401 ESSATVKKRVIAAHERQYRRQKKLNARLEGREIQKYCVLRHDDARWLEDTLVHLGLSIRAWQRLLKVARTIADIELADQI 480
296105340 401 ESTAKVRERVIASQARQYARQHKLNARLDNAEIRQFCHLKAEDACWLEETLTRFGLSIRAWQRLLKVARTIADVEGDPEI 480
161617016 401 ENSATVKKRVIAAHERQYRRQKKLNARLEGREIQKYCVLHHDDARWLEDTLVHLGLSIRAWQRLLKVARTIADIELADQI 480
197250076 401 ESSATVKKRVIAAHERQYRRQKKLNARLEGREIQKYCILHHDDARWLEDTLVHLGLSIRAWQRLLKVARTIADIELADQI 480
198242242 401 ESSATVKKRVIAAHERQYRRQKKLNARLEGREIQKYCVLHHDDARWLEDTLVHLGLSIRAWQRLLKVARTIADIELADQI 480
194445964 401 ESSATVKKRVIAAHERQYRRQKKLNARLEGREIQKYCVLHHDDARWLEDTLVHLGLSIRAWQRLLKVARTIADIELADQI 480
161505582 433 ENSATVKKRVIAAQERQYRRQKKLNARLEGSEIQKYCVLHHDDARWLEDTLVHLGLSIRAWQRLLKVARTIADIEQADEI 512
194448893 401 ENSATVKKRVIAAHERQYRRQKKLNARLEGREIQKYCVLHHDDARWLEDTLVHLGLSIRAWQRLLKVARTIADIELADQI 480
15804357  491 TRQHLQEAVSYRAIDRLLIHLQKLLT 516
62182376  481 SRQHLQEAVSYRAIDRLLIHLQKLLA 506
205354528 481 SRQHLQEAVSYRAIDRLLIHLQKLLA 506
296105340 481 ERHHLQEALSYRAIDRLLLHLQKLLA 506
161617016 481 SRQHLQEAVSYRAIDRLLIHLQKLLA 506
197250076 481 SRQHLQEAVSYRAIDRLLIHLQKLLA 506
198242242 481 SRQHLQEVVSYRAIDRLLIHLQKLLA 506
194445964 481 SRQHLQEAVSYRAIDRLLIHLQKLLA 506
161505582 513 SRQHLQEAVSYRAIDRLLIHLQKLLA 538
194448893 481 SRQHLQEAVSYRAIDRLLIHLQKLLA 506
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap