Conserved Protein Domain Family
PRK09762

?
PRK09762: PRK09762 
galactosamine-6-phosphate isomerase; Provisional
Statistics
?
PSSM-Id: 182064
View PSSM: PRK09762
Aligned: 31 rows
Threshold Bit Score: 377.633
Threshold Setting Gi: 305666926
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
150009464   1 MRIEICQSYEALSLKAKEIVTSELGQHKALTLCAATGGSPTRMYELLVEEAGRQPELFSQFTVLKLDEWGGIPMDHPGTC 80 
218560217  20 QTLQQVENYTALSERASEYLLAVIRRKPDAVICLATGATPLLTYHYLVEKIHQQQVDVSQLTFVKLDEWVDLPLTMPGTC 99 
91212563   20 QTLQQVENYTALSERASEYLLAVIRRKPDAVICLATGATPLLTYHYLVEKIHQQQVDVSQLTFVKLDEWVDLPLTMPGTC 99 
117625441  20 QTLQQVENYTALSERASEYLLAVIRRKPDAVICLATGATPLLTYHYLVEKIHQQQVDVSQLTFVKLDEWVDLPLTMPGTC 99 
26249725   20 QPLQQVENYTALSERASEYLLAVIRRKPDAVICLATGATPLLTYHYLVEKIHQQQVDVSHLTFVKLDEWVDLPLTMPGTC 99 
110643386  20 QTLQQVENYTALSERASEYLLAVIRRKPDAVICLATGATPLLTYHYLVEKIHQQQVDVSQLTFVKLDEWVDLPLTMPGTC 99 
218551565  20 QTLQQVENYTALSERASEYLLAVIRSKPDAVICLATGATPLLTYHYLVEKIHQQQVDVSQLTFAKLDEWVDLPLTMPGTC 99 
146313217   4 ITFQVQSDKRSLSEAASEKLLALIHRKPDAVICLATGATPVMTYQLLVEKIIAQQVDISRITFVKLDEWVGLAPDNPATC 83 
218706765  20 QTLQQVENYTALSERASEYLLAVIRSKPDAVICLATGATPLLTYHYLVEKIHQQQVDVSQLTFVKLDEWVDLPLTMPGTC 99 
215488464   2 QPLQQVENYTALSERASEYLLAVIRSKPDAVICLATGATPLLTYHYLVEKIQQQQVDVSQLTFVKLDEWVDLPLTMPGTC 81 
150009464  81 ESYLRNYFVGPLQIPEDRYIAFQSDPENpEAECERIQQILDQKGPIDICILGIGMNGHIALNEPAPSLHTNCHVAHLSQK 160
218560217 100 ETFLQQHIVQPLGLREDQLISFHSEEIN-ETECERVTNLIARKGGLDLCVLGLGKNGHLGLNEPGESLQPACHISQLDAR 178
91212563  100 ETFLQQHIVQPLGLREDQLISFHSEEIN-ETECERVTNLIARKGGLDLCVLGLGKNGHLGLNEPGESLQPACHISQLDAR 178
117625441 100 ETFLQQHIVQPLGLREDQLISFHSEEIN-ETECERVTNLIARKGGLDLCVLGLGKNGHLGLNEPGESLQPACHISQLDAR 178
26249725  100 ETFLQQHIVQPLGLREDQLISFRSEEIN-ETECERVTNLIARKGGLDLCVLGLGKNGHLGLNEPGESLQPACHISQLDAR 178
110643386 100 ETFLQQHIVQPLGLREDQLISFHSEEIN-ETECERVTNLIARKGGLDLCVLGLGKNGHLGLNEPGESLQPACHISQLDAR 178
218551565 100 ETFLQQHLVQPLGLREDQLISFRSEEIN-ETECERVTNLIARKGGLDLCVLGLGKNGHLGLNEPGESLQPASHISQLDAR 178
146313217  84 EVFLQHHILQPLGIAPENYISFRSDNAD-EQECARIVEQIAQRGGLDLCVLGIGKNGHLGLNEPDEKLEPACHITHLDER 162
218706765 100 ETFLQQHIVQPLGLREDQLISFRSEEIN-ETECERVTNLIARKGGLDLCVLGLGKNGHLGLNEPGENLQPACHISQLDAR 178
215488464  82 ETFLQQHIVQPLGLREDQLISFHSEEIN-ETECERVTNLIARKGGLDLCVLGLGKNGHLGLNEPGEILQPACHISQLDAR 160
150009464 161 SLQHPMIAGDMEKPGYGLTLGMANIFQSRLIILLINGIKKREITQAFLEQKISTELPASLLWLHPNVICLIDR 233
218560217 179 TQQHEMLKTADRPVTRGITLGLKDILNAREVLLLVTGEGKQDATERFLTAKVSTAIPASFLWLHNYFTCMIDE 251
91212563  179 TQQHEMLKTADRPVTRGITLGLKDILNAREVLLLVTGEGKQDATERFLTAKVSTAIPASFLWLHNYFTCMIDE 251
117625441 179 TQQHEMLKTADRPVTRGITLGLKDILNAREVLLLVTGEGKQDATERFLTAKVSTAIPASFLWLHNYFTCMIDE 251
26249725  179 TQQHEMLKTADRPVTRGITLGLKDILNAREVLLLVTGEGKQDATERFLTAKVSTAIPASFLWLHNHFTCVIDE 251
110643386 179 TQQHEMLKTADRPVTRGITLGLKDILNAREVLLLVTGEGKQDATERFLTAKVSTAIPASFLWLHNHFTCVIDE 251
218551565 179 TQQHEMLKTAGRPVTRGITLGLKDILNAREVLLLVTGEGKQDATERFLTAKVSTAIPASFLWLHNHFTCMIDE 251
146313217 163 TRLHEMLKQANVPVEKGITLGLRDILAAREVLLLVSGEGKQRAFAAFKEGKVTTQIPASFLWLHPKTTCLYCD 235
218706765 179 TQQHEMLKTAGRPVTRGITLGLKDILNAREVLLLVTGEGKQDATERFLTAKVSTAIPASFLWLHNHFTCVIDE 251
215488464 161 TQQHEMLKTADRPVTRGITLGLKDILNASEVLLLVTGEGKQDATERFLTAKVSTAIPASFLWLHNYFTCMIDE 233
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap