Conserved Protein Domain Family
nudB

?
PRK09438: nudB 
dihydroneopterin triphosphate pyrophosphatase; Provisional
Statistics
?
PSSM-Id: 236516
View PSSM: PRK09438
Aligned: 155 rows
Threshold Bit Score: 206.283
Threshold Setting Gi: 109899254
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 295675470   3 KPPKIPQSVLVIIHTPALDVLLLERADHAAFWQSVTGSKDRlDEPLADTAVREVGEETGIMVggaLVPRSALFDWQYSID 82
gi 196156537   1 MAYKKPESALVVLFDQHYQVLLLQRQDDPTFWQSVTGALEE-GELPIETAYREVCEEIGIDA---KAHGFVLNDHKKQNQ 76
gi 59800677    5 KPLKYPVSALVVLYSGDGGILLIERTHPKGFWQSVTGSLEP-GETVAQTARREVWEETGI-----LLEDGQLQDRHDSTV 78
gi 194097938   5 KPLKYPVSALVVLYSGDGGILLIERTHPKGFWQSVTGSLEP-GETVAQTARREVWEETGI-----LLEDGQLQDRHDSTV 78
gi 254804524   5 KPLKYPVSALVVLYSGDGGILLIERTHPKGFWQSVTGSLEP-GETVAQTAKREVWEETGI-----LLADEQLQDRHDSTV 78
gi 15676542    5 KPLKYPVSALVVLYSGDGGILLIERTHPEGFWQSVTGSLEP-GETVAQTARREVWEETGI-----LLADGQLQDWHDSTV 78
gi 218767775   5 KPLKYPVSALVVLYSGDGGILLIERTHPKGFWQSVTGSLEP-GETVAQTARREVWEETGI-----LLADGQLQDWHDSTV 78
gi 121634434   5 KPLKYPVSALVVLYSGDGGILLIERTHPEGFWQSVTGSLEP-GETVAQTARREVWEETGI-----LLADGQLQDWHDSTV 78
gi 161869575   5 KPLKYPVSALVVLYSGDGGILLIERTHPEGFWQSVTGSLEP-GETVAQTARREVWEETGI-----LLADGQLQDWHDSTV 78
gi 56477893    4 LPYKRPISVLVVIHTTTLQVLLLERVVPAGFWQSVTGSLEA-DESPLQAAIREVNEETGLAV-----SAGQLRDWHHTNR 77
                         90       100       110       120       130       140       150
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 295675470  83 YEIYPEFRYRYEAGVLYNTEHWFSLQVPERIDVSLAprEHTAYMWLPYEEAASRCFSSSNADAILQLPRRLA 154
gi 196156537  77 YEIRSRWLHRYPPGTVHNTEHVFSLQINSELPLILT--EHLQYEWVSKEEALARLWSPSNKEAVSLFVPSVP 146
gi 59800677   79 YEIYHHWRHRYPKGVFENREHVFRAEIPRDTPVVLQpeEHVSYGWFGLEEAAEKVFSPSNRRAILELGRFLG 150
gi 194097938  79 YEIYHHWRHRYPKGVFENREHVFRAEIPRDTPVVLQpeEHVSYGWFGLEEAAEKVFSPSNRRAILELGRFLG 150
gi 254804524  79 YEIYHHWRHRYPKGVFENREHLFSAEIPRDTPIALQpeEHVSYGWFGLEEAAEKVFSPSNRRAILELGRFLG 150
gi 15676542   79 YEIYHHWRHRYPKGVFENREHLFSAEIPRDTPIALQpeEHVSYGWFDMEEAAEKVFSPSNRRAILELGRFLG 150
gi 218767775  79 YEIYHHWRHRYPKGVFENREHLFSAEIPRDTPIVLQpeEHVSYGWFDMEEAAEKVFSSSNRCAILELGRFLG 150
gi 121634434  79 YEIYHHWRHRYPKGVFENREHLFSAEIPRDTPIALQpeEHVSYGWFDMEEAAEKVFSPSNRRAILELGRFLG 150
gi 161869575  79 YEIYHHWRHRYPKGVFENREHLFSAEIPRDTPIALQpeEHVSYGWFDMEEAAEKVFSPSNRRAILELGRFLG 150
gi 56477893   78 FEIIEDWRARYAPDVTHNTEHVFSLCVPAPRPVRLApaEHRLQLWLPLEEAAGKASSWTNRDAILMLPHIAG 149
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap