Conserved Protein Domain Family
PRK09415

?
PRK09415: PRK09415 
RNA polymerase factor sigma C; Reviewed
Links
?
Statistics
?
PSSM-Id: 181835
View PSSM: PRK09415
Aligned: 28 rows
Threshold Bit Score: 244.657
Threshold Setting Gi: 288555447
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 51892045    1 MSQSDRAALPSD----RTAAIDHLMREYGTKVLHLAYSYLKDRHLAEDVAQEVFIKAYRNWENFRGESSAYTWLYRITVN 76
gi 16802467    4 LEEIGIHINSIEn---TEQIISQLMDNYSDDVLHLVFSYVKNRTTAEDLTQEIFIKCYEKLDQFNNKSSIKTWLYRIAIN 80
gi 284800709   4 LEEIGIHINSIEn---TEQIISQLMDNYSDDVLHLVFSYVKNRTTAEDLTQEIFIKCYEKLDQFNNKSSIKTWLYRIAIN 80
gi 284993895   4 LEEIGIHINSIEn---TEQIISQLMDNYSDDVLHLVFSYVKNRTTAEDLTQEIFIKCYEKLDQFNNKSSIKTWLYRIAIN 80
gi 229604778   1 MDELTVEAFEIEd---KEDLIDEIMNKYGQEVLQLVYSYVNNKEVAEDVTQDIFVKCYKSLHTYKGNSNLKTWLWRIAIN 77
gi 47777889    1 MDELTVEAFEIEd---KEDLIDEIMNKYGQEVLQLVYSYVNNKEVAEDVTQDIFVKCYKSLHTYKGNSNLKTWLWRIAIN 77
gi 15615924    1 MESLPGKIGEIEtaemREHQLIAWMEEYGTAILRVVYSYVKDKQIAEDLTQEVFVRAFQSYHTYQTRSSAKAWLYRIAIN 80
gi 288555447   8 TEEKEMD---------KEALLTELMNEYGNGVLKLIFSYVHQQDIAEDLAQEVFVKVYQKIDQFEQRASLKTWLYRIAIN 78
gi 294500199   1 MKELTVEWIQVQd---KELVIDEIMDRYGQEILQLAYSYVNSVAVAEDLTQEIFIKCYKNLYRYSGKSKFRTWLWQIAIN 77
gi 16799520    4 LEEIGININSIEn---TEQIISQLMDNYSDDVLHLVFSYVKNRTTAEDLTQEIFIKCYEKLDQFNNKSSIKTWLYRIAIN 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 51892045   77 LCRDKARSAWWRRLLPTDDpRAAGTPVEPDTAgddpEEAVVLSDQRERLLDYVMQLSDAYREVIILYYYHDLTTVEIAEV 156
gi 16802467   81 HCKDYLGSWHYRKLNFNDK-IWDYLPSKSKHV----EEEVIAKDVANSLMSAVMDLPVKYREVVFLHYYEELPLANISKI 155
gi 284800709  81 HCKDYLGSWHYRKLNFNDK-IWDYLPSKSKHV----EEEVIAKDVANSLMSAVMDLPVKYREVVFLHYYEELPLANISKI 155
gi 284993895  81 HCKDYLGSWHYRKLNFNDK-IWDYLPSKSKHV----EEEVIAKDVANSLMSAVMDLPVKYREVVFLHYYEELPLANISKI 155
gi 229604778  78 HCKDYLKSWYNKKVIVTED-DFTYMESQKESV----EQIVIQNAEDSRLASAVMSLPIKYREVIYLFYYEELSIKEIATV 152
gi 47777889   78 HCKDYLKSWYNKKVIVTED-DFTYMESQKESV----EQIVIQNAEDSRLASAVMSLPIKYREVIYLFYYEELSIKEIATV 152
gi 15615924   81 RSKDFLKSWHAKHVYPSE--VAEEIETTEQTP----EYEVLLKSDEERLAAAVFSLPLSYREVIYFYYYEELSVKEVASF 154
gi 288555447  79 SSKDYLKSWHTKNVQTSEEgNMIEHMVDLRTP----ESNLIERTEEEELVTKVLSLPLMYKEVIYLYYYEEYSIQEISEL 154
gi 294500199  78 HCKDFLKSWYNKNIIPATD-YFPNHISEKESI----EEAVIQHEEDHELMSAVMKLPTKYKEVIYLFYYEELLIKDIALV 152
gi 16799520   81 HCKDYLGSWHYRKLNFSEK-IWNYLPSKSKHV----EEEIIAKDVANSLMSAVMDLPVKYREVVFLHYYEELSLANISKI 155
                        170       180
                 ....*....|....*....|....*..
gi 51892045  157 TGQNENTVKTRLFRARAMLKQMLQKGG 183
gi 16802467  156 TGVNSNTLKTRLKQARELLKNKMKKEV 182
gi 284800709 156 TGVNSNTLKTRLKQARELLKNKMKKEV 182
gi 284993895 156 TGVNSNTLKTRLKQARELLKNKMKKEV 182
gi 229604778 153 IEVKENTIKTRLKKAKELLKKGLEE-- 177
gi 47777889  153 IEVKENTIKTRLKKAKELLKKGLEE-- 177
gi 15615924  155 TGLNENTVKTRLRKGRLLLKNLLEKED 181
gi 288555447 155 LQINKNTVKTRLFQARKKLKQSFVGGV 181
gi 294500199 153 TKTGTNTVKTRLRRAKSLLKEMLEE-- 177
gi 16799520  156 TGVNSNTLKTRLKHARELLKTKMKKEV 182
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap