Conserved Protein Domain Family
pyrC

?
PRK09357: pyrC 
dihydroorotase; Validated
Links
?
Statistics
?
PSSM-Id: 236479
View PSSM: PRK09357
Aligned: 267 rows
Threshold Bit Score: 351.42
Threshold Setting Gi: 150020170
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189346779   2 STIFQRAHLLNPAeNLDATGSIRIDGSGFIEsvslgs--admphnDDDRVIDLDGKLLVPGLFDMHCHFREPGQEYKETL 79
gi 238925256   1 -MIIKNGIIADPAsGLYEHMDILVKDGKIVKispdiscasdaaatEKEEIIDASGMIVGPGLIDTHVHFRDPGFTYKEDI 79
gi 170288396   1 ------MRIYDPFrKKWiee-------------------------eieTPFPSKGLVATFPFVDLHVHVRLNGGEDYSSL 49
gi 15643103    1 ------MRIYDP-----------FRKKWIEE--------------EIETPFPSKGLVATFPFVDLHVHVRLNGGEDYSSL 49
gi 222099308   1 ----MDGKIT----GKEFGGKSVRIYDPFRKkwie---------eeieTPFPSKGLVATFPFVDLHVHVRLNGGEDYSSL 63
gi 148269721   1 ------MRIYDPFrKKWiee-------------------------eieTPFPSKGLVATFPFVDLHVHVRLNGGEDYSSL 49
gi 281412395   9 EFGGKNVRIYDPFrKRWiee-------------------------eieTPFPSKGLVATFPFVDLHVHVRLNGGEDYNSL 63
gi 217076622   1 ------MKYISVKvYDPYQKKLFYEEISLPK------------------NIHYENLVVVPTFFDFHTHVRL--LEDQEDY 54
gi 150020170     --------------------------------------------------------------------------------
gi 154249160   1 ---MESLKVYNIYkGKIEDFELKDIELDFPE-----------------NPATTNGLLLSPPFVDLHTHVRLIDGEDYDSL 60
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189346779  80 ETGSSAAAAGGYTGVALMPNTRPVIDSPLGVAYIRHHSALLP-VDLEVIGAMTVESRGETLAPFGKFRS--YGVTAISDD 156
gi 238925256  80 HTGSLAAAKGGFTTVVCMANTKPTVDNVDTLKDNLTRGKQEK-IRMYQAAAISHSLKGQDEVDMAALKE--AGACGFTDD 156
gi 170288396  50 EE---ASLVGGFFKVVVQPNTKPLIDSKEVLERHLDLSKNRAvEFLFAVSP------------FGSIEAegERVVGFSTD 114
gi 15643103   50 EE---ASLVGGFFKVVVQPNTKPLIDSKEVLERHLDLSKNRAvEFLFAVSP------------FGSIEAegERVVGFSTD 114
gi 222099308  64 EE---ASLVGGFFKVVVQPNTKPLIDSKEVLERHLDLSKNRAvEFLFAVSP------------FGSIEAegERVVGFSTD 128
gi 148269721  50 EE---ASLVGGFFKVVVQPNTKPLIDSKEVLERHLDLPKNRAvEFLFAVSP------------FGSIEAegERVVGFSTD 114
gi 281412395  64 EE---ASLVGGFFKMVVQPNTKPPIDNKEVLERHLDLSRNKAvEFLFTVSP------------FGSIEAegERVVGFSTD 128
gi 217076622  55 ESLKKACIAGGFSEVLIQPNTKPRLENSNVHEK-HKKLSENPyVKFYR----TTSF-------FGFQEPnnIDILCYSTD 122
gi 150020170   1 --------------MLIQPNTNPILENKQVHKYHEKLVADSH-VRFYRTTSLFGTQKPS------------DNILCYSTD 53
gi 154249160  61 T---KAAVVGGFLIVNLQPNTKPVIDSLDVLNEHIKLSEDKIvLYNYTVSLF-----GKVEDLYDANSQfgEKITGYSTD 132
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189346779 157 GTAIQNTQIMRLAFEYASNFDLLIIQHCEDKTLTKG-GVMNESHFSTILGLKGIPDVAEAIIVSRDLQLMrylqqhklhd 235
gi 238925256 157 GIPLTNAAFCYRAMQNAAKLDMPISLHEEDPAFIKN-NGINHGKISDALGIYGSPSIAEEALVARDCLLA---------- 225
gi 170288396 115 GIEYDYPTLVETMKKKKKALWFDHSQMYEVDGIFYE---------GAPLPFQKRPRSNEAIAIARTVLTG---------- 175
gi 15643103  115 GIEYDYPTLVETMKKKKKALWFDHSQMYEVDGIFYE---------GAPLPFQKRPRSNEAIAIARTVLTG---------- 175
gi 222099308 129 GIEYDYPTLVETMKKKKKAL------WFDHSQMYEVdGIFYEG---APLPFQKRPRSNEAIAIARTVLTG---------- 189
gi 148269721 115 GIEYDYPTLVETMKKKKKALWFDHSQMYEVDGIFYE---------GAPLPFQKRPRSNEAIAIARTVLTG---------- 175
gi 281412395 129 GIEYDYHALVESMKKRKKALWFDHSQMYEVDGIFYE---------GTPLPFPKRPRSNEAIAITRTVLTG---------- 189
gi 217076622 123 GIEYNYNELVENFSKKKPHLLLDHSQMFEHPGIFYK----------KIENLPKRPVTNEAVAVARTILTG---------- 182
gi 150020170  54 GIKYTYNDLVENFSRKKPALVLDHSQLFEHEGIFYK----------EILDIPKRPITNEAIAIARTVLTG---------- 113
gi 154249160 133 GIYYYSEDLVDGFKNKKPYLLFDHSQLHELSGDFYI---------GTNLPNSIRTYSNESIAIFRTVMTG---------- 193
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189346779 236 PLNQ-PRYHVAHISTGAALDLVRQAKLDGLQVTCEVTPHHFTLSDEdlFLAEAKGNFIMKPPLGSAENMQALIDAIADGT 314
gi 238925256 226 LRSG-ADVVIQHISSGVSVDIVRTYKKLGARLHAEATPHHFTLTED--AVLEHGTLAKMNPPLRTEADRQKIIEGLIDGT 302
gi 170288396 176 LEYGfERFHIQHVTTKYSVEVISFLKNLA-KVSCEVTPHHLFFCYE--DIK--NTNFKINPPLGSPEDRRALIEAVKKDV 250
gi 15643103  176 LEYGfERFHIQHVTTKYSVEVISFLKNLA-KVSCEVTPHHLFFCYE----DIKNTNFKINPPLGSPEDRRALIEAVKKDV 250
gi 222099308 190 LEYGfERFHIQHVTTKYSVEVISFLKNLA-KVSCEVTPHHLFFCYE--DIK--NTNFKINPPLGSPEDRRALIEAVKKDV 264
gi 148269721 176 LEYGfERFHIQHVTTKYSVEVISFLKNLA-KVSCEVTPHHLFFCYE--DIK--NTNFKINPPLGSPEDRRALIEAVKKDV 250
gi 281412395 190 LEYGfERFHIQHVTTKYSVEVISFLKNLA-KVSCEVTPHHLFFCYE--DIK--NTNFKINPPLGSPEDRKALIEAVKEDV 264
gi 217076622 183 IEFGfKDFHIQHISSIYTLEMIKFLKKYA-NITCEVTPHHLLLTNE--HIK--NSNFKINPPLADQQTREFLIEAVKNND 257
gi 150020170 114 FEFGfKDFHIQHISTTYSLEMIEFLKKCA-NITCEVTPHHLLISNE--EIL--NPNFKINPPLCDKKTIEILKDAVKTNK 188
gi 154249160 194 IEFGfNKFHIQHVSTLQSIEVITYLKKYA-QITCEVTPHHVFFTPD----MISSPNQKINPPISK--YRDELIKAVRSGI 266
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189346779 315 IDAIATDHAPHAAHEKDCPPDQAAFGITGLETAVGLTLTELVSKNVITMQRAIEMLSVNPRKIMN---------LAPVHF 385
gi 238925256 303 IDLIATDHAPHSTEEKSKPVTEAPSGIIGLETSLALGITSLVKPGHLSMLELLEKMTINPARLYH---------MPYGTI 373
gi 170288396 251 IDVLATDHAPHHEKPD--DFLTAPYGSTSIEIAFPAYYTA-----LGDLELVVKKLTKKPLEVLG---------VEA--- 311
gi 15643103  251 IDVLATDHAPHHEKPDD--FLTAPYGSTSIEIAFPAYYTA-----LGDLELVVKKLTKKPLEVLG---------VEA-RL 313
gi 222099308 265 IDVLATDHAPHHEKPD--DFLTAPYGSTSIEIAFPAYYTA-----LGDLELVVKKLTKKPLEVLG---------VEA--- 325
gi 148269721 251 IDVLATDHAPHHEKPD--DFLTAPYGSTSIEIAFPAYYTA-----LGDLELVVKKLTKKPLEVLG---------VEA--- 311
gi 281412395 265 IDVLATDHAPHHEKPD--DFLTAPYGSTSIEIAFPAYYTA-----LGDLELVVEKLTKKPLEVLG---------VEA--- 325
gi 217076622 258 IDILATDHAPHPDKKN--DFEKAPYGTSNIEIAFSAFYTA-----IEDLMIVINKLCDTPRRRLK---------IKP--- 318
gi 150020170 189 IDILATDHAPHPEKPA--DYRKAPYGTSNIEIAFSAFYTA-----LNDVYLVTDKLCYAPRKRLG---------ISY--- 249
gi 154249160 267 IDTFATDHAPHPEKPVR--YEDAPYGSSHIEVAFSVYLTI-----FEDIELVLKNLTVKPLKILGksyadfnmnFPS--- 336
                        410       420       430       440       450
                 ....*....|....*....|....*....|....*....|....*....|....*
gi 189346779 386 RAGEMANMTIIDPEvEWTVTKDDMKSRSQNTPFIGRRLKGRAVGIYHKGALLENR 440
gi 238925256 374 SEGAAADFVIFDPDeKWV--PCEYASKSSNTPFTGMELTGKVKYTVCGGNVIYSD 426
gi 170288396 312 -RLTEDTLVFIDPEaEFIVDAKKFKSKGKNSMFDGVRLKGKVVALKLKGRWVMID 365
gi 15643103  314 TE---DTLVFIDPEaEFIVDAKKFKSKGKNSMFDGVRLKGKVVALKLKGRWVMID 365
gi 222099308 326 -RLTEDTLVFIDPEaEFIVDAKKFKSKGKNSMFDGVRLKGKVVALKLKGRWVMID 379
gi 148269721 312 -RLTEDTLVFIDPEaEFIVDAKKFKSKGKNSMFDGVRLKGKVVALKLKGRWVMID 365
gi 281412395 326 -HLTEDTLVFIDPKaEFIVDVKKFKSKGKNSMFDGVRLKGRVVALKLKGRWVMID 379
gi 217076622 319 -KFDSENFVVVDLNqEFIVDSKKFYSKGKNCAFDGMKLKGKVVGVKINGKWGFWN 372
gi 150020170 250 -KFTSDNLVIVDLNqEFTVESKRFFSKGKNCAFDGMKLKGKIIGVKINGKWGYWN 303
gi 154249160 337 -----DA-VLIDTKaEYIVDGNNFYSKGKNCAFNGYKVKGKVLGVRRNGRWVYWD 385
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap