Conserved Protein Domain Family
PRK09329

?
PRK09329: PRK09329 (this model, PSSM-Id:103833 is obsolete)
N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional
Statistics
?
PSSM-Id: 103833
View PSSM: PRK09329
Aligned: 15 rows
Threshold Bit Score: -1
Threshold Setting Gi: 0
Created: 23-Mar-2010
Updated: 25-Mar-2010
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16752930    3 IKKAIQEGTAYLDYYGVPLSDCEALYILMDLLEVSSRAKLFDLVgISETMLMEYRKRLALRGQRCPTAYLNGAVSFLGLR 82
gi 76788736    1 MKKLLREASEYLLSRGIRFPQREAEDILMDLLEISSRSALHQAK-LSSEEQSLYWKRLRKRGDRCPTAYIHGKVHFLGVE 79
gi 166154245   1 MKKLLREASEYLLSRGIRFPQREAEDILMDLLEISSRSALHQAK-LSSEEQSLYWKRLRKRGDRCPTAYIHGKVHFLGVE 79
gi 166155120   1 MKKLLREASEYLLSRGIRFPQREAEDILMDLLEISSRSALHQAK-LSSEEQSLYWKRLRKRGDRCPTAYIHGKVHFLGVE 79
gi 237804373   1 MKKLLREASEYLLSRGIRFPQREAEDILMDLLEISSRSALHQAK-LSSEEQSLYWKRLRKRGDRCPTAYIHGKVHFLGVE 79
gi 62185242    3 TKKILKEAAAYLEYCGVVFSDREAVDILMDVLGITSRAQVLSVR-LNADTLHVYWTRIQKRAERFPTAYIHGSVRFLQLD 81
gi 29840417    3 TKRILREAAAYLKCCGVAFPDREAADVLMDFLEIRSRAQLASIT-LDEHLIPAYWERIQKRAQRYPTAYIHGSVHFLGLH 81
gi 15618038    3 IKKAIQEGTAYLDYYGVPLSDCEALYILMDLLEVSSRAKLFDLVgISETMLMEYRKRLALRGQRCPTAYLNGAVSFLGLR 82
gi 15835650    3 IKKAIQEGTAYLDYYGVPLSDCEALYILMDLLEVSSRAKLFDLVgISETMLMEYRKRLALRGQRCPTAYLNGAVSFLGLR 82
gi 33241450   11 IKKAIQEGTAYLDYYGVPLSDCEALYILMDLLEVSSRAKLFDLVgISETMLMEYRKRLALRGQRCPTAYLNGAVSFLGLR 90
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16752930   83 LRVDSRVLIPRTETELLAEYIINYLLSHSEIQTFYDICCGSGCLGLAIKKSCPHVEVVLSDVCPQAVAVANENAKSNGLD 162
gi 76788736   80 LQVTPQVLIPRQETEIFVEQIIGYLQMHKEKTTFYDVCCGSGCIGLAVRKHCPHVRVTLSDISPEALAIAESNARSNALA 159
gi 166154245  80 LQVTPQVLIPRQETEIFVEQIIGYLQMHKEKTTFYDVCCGSGCIGLAVRKHCPHVRVTLSDISPEALAIAESNARSNALA 159
gi 166155120  80 LQVTPQVLIPRQETEIFVEQIIGYLQMHKEKTTFYDVCCGSGCIGLAVRKHCPHVRVTLSDISPEALAIAESNARSNALA 159
gi 237804373  80 LQVTPQVLIPRQETEIFVEQIIGYLQMHKEKTTFYDVCCGSGCIGLAVRKHCPHVRVTLSDISPEALAIAESNARSNALA 159
gi 62185242   82 LEVDSRVLIPRMETELLAEKIIQYLTQHPHIQTFYDVCCGSGCLGLSIKKYCPNVQVILSDICPKAVAVAKINASKNHLQ 161
gi 29840417   82 LEVDSRVLIPRMETELLAEQIVKYLSDHPHIQTFYDVCCGSGCLGLSIKKYCPNIQVILSDICSKAVAVAKTNAFKNNLN 161
gi 15618038   83 LRVDSRVLIPRTETELLAEYIINYLLSHSEIQTFYDICCGSGCLGLAIKKSCPHVEVVLSDVCPQAVAVANENAKSNGLD 162
gi 15835650   83 LRVDSRVLIPRTETELLAEYIINYLLSHSEIQTFYDICCGSGCLGLAIKKSCPHVEVVLSDVCPQAVAVANENAKSNGLD 162
gi 33241450   91 LRVDSRVLIPRTETELLAEYIINYLLSHSEIQTFYDICCGSGCLGLAIKKSCPHVEVVLSDVCPQAVAVANENAKSNGLD 170
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16752930  163 VKILLGDLSAPYTRPADAFVCNPPYLSFNEIIHIDPEVRCYEPWKALVGGSTGLEFYQRIAQELPKIVTSTGVGWLEIGS 242
gi 76788736  160 VDFLLGDLFDPFSFPADVLVCNPPYLSYKEFFESDPEVRCHEPWKALVGGVSGLEFYHRIATHIHKILVSGGVGWLEIGS 239
gi 166154245 160 VDFLLGDLFDPFSFPADVLVCNPPYLSYKEFFESDPEVRCHEPWKALVGGVSGLEFYHRIATHIHKILVSGGVGWLEIGS 239
gi 166155120 160 VDFLLGDLFDPFSFPADVLVCNPPYLSYKEFFESDPEVRCHEPWKALVGGVSGLEFYHRIATHIHKILVSGGVGWLEIGS 239
gi 237804373 160 VDFLLGDLFDPFSFPADVLVCNPPYLSYKEFFESDPEVRCHEPWKALVGGVSGLEFYHRIATHIHKILVSGGVGWLEIGS 239
gi 62185242  162 VDVLEGDLFAPFSCPADAFVCNPPYLSFDEIMQTDPEVRCHEPWKALVGGSSGLEFYERIARDLDTILCPGGVGWLEIGY 241
gi 29840417  162 VEILNGDLFAPYSCPGDAFVCNPPYLSFDEILHVDPEVRCHEPWKALVGGSSGLEFYERIANELNTILLPRGVGWLEIGY 241
gi 15618038  163 VKILLGDLSAPYTRPADAFVCNPPYLSFNEIIHIDPEVRCYEPWKALVGGSTGLEFYQRIAQELPKIVTSTGVGWLEIGS 242
gi 15835650  163 VKILLGDLSAPYTRPADAFVCNPPYLSFNEIIHIDPEVRCYEPWKALVGGSTGLEFYQRIAQELPKIVTSTGVGWLEIGS 242
gi 33241450  171 VKILLGDLSAPYTRPADAFVCNPPYLSFNEIIHIDPEVRCYEPWKALVGGSTGLEFYQRIAQELPKIVTSTGVGWLEIGS 250
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|....*.
gi 16752930  243 SQGESIKNIFSKHGIYGRLHQDLSGRDRIFFLEMDGRDPVSSGAYS 288
gi 76788736  240 TQGEDVKQIFHAKGIRGRVLKDYAQLDRFFFLENQANDAVSSGEVS 285
gi 166154245 240 TQGEDVKQIFHAKGIRGRVLKDYAQLDRFFFLENQANDAVSSGEVS 285
gi 166155120 240 TQGEDVKQIFHAKGIRGRVLKDYAQLDRFFFLENQANDAVSSGEVS 285
gi 237804373 240 TQGEDVKQIFHAKGIRGRVLKDYAQLDRFFFLENQANDAVSSGEVS 285
gi 62185242  242 SQGERVKRIFANHGVHGSIHQDLSACDRIFFLENHASDTVSS---- 283
gi 29840417  242 KQGSSVKRIFANRGISGNIYQDLSGCDRIFFLENHASDAVSS---- 283
gi 15618038  243 SQGESIKNIFSKHGIYGRLHQDLSGRDRIFFLEMDGRDPVSSGAYS 288
gi 15835650  243 SQGESIKNIFSKHGIYGRLHQDLSGRDRIFFLEMDGRDPVSSGAYS 288
gi 33241450  251 SQGESIKNIFSKHGIYGRLHQDLSGRDRIFFLEMDGRDPVSSGAYS 296
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap