Conserved Protein Domain Family
PRK09268

?
PRK09268: PRK09268 
acetyl-CoA acetyltransferase; Provisional
Statistics
?
PSSM-Id: 236440
View PSSM: PRK09268
Aligned: 115 rows
Threshold Bit Score: 672.381
Threshold Setting Gi: 152967971
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
172040815   2 TNGNQKKVAILGGNRIPFARSNKEYADASNQDMLTAAIEGLVARYGLQDEELGLVTGGAVLKHSRDFNMVREVVLGSSLS 81 
146301065   3 TSKTVRKVAIVGYNRIPFARANTAYASVGNQEMMTAALNGLVDKYNLQGQLLGEVAGGAVIKHTYDNNLIRECVMKTALD 82 
84625515    5 PMPAARPVAILGGVRIPFCRQNTAYADVGNMGMSVRTLGALVERFGLHGQQLGEVAMGAVIKHSSDWNLAREATLSSGLS 84 
188575023   1 --------------------------------MSVRTLGALVERFGLHGQQLGEVAMGAVIKHSSDWNLAREATLSSGLS 48 
285019846  11 LMPAARPVAILGGVRIPFCRQNTVYADVGNLGMSVRTLGALVERYGLHGQQLGEVAMGAVIKHASDWNLGREAALSSGLS 90 
42523542    3 NRKTMRPVAILAGSRTPFTKSFTNYSRTSNRELMTATVRDLVDKTQLRGALLGDVSLGAVMKNASDWNLARETVLGAGLD 82 
120554933  14 ASQGIRRVAVIGGNRIPFARSNTAYSKISNQELLTSALRGLVDRFNLDGMKMGEVVAGAVIKHSRDFNLTRESVLSCGLA 93 
304312828   2 KVNTVRRVAILGGNRIPFARSNTAYSEASNQDMLTAALNGLIERFKLQGERMGEVVAGAVIKHSRDFNLTRECVLSTALA 81 
194363906   5 SMPNARPVAILGGVRIPFCRQNTAYSDVGNLGMSVRTLGALVERFGLHGQQLGEVAMGAVIKHSSDWNLGREATLSSGLS 84 
190572243   5 SMPNARPVAILGGVRIPFCRQNTAYSDVGNLGMSVRTLGALVERFGLHGQQLGEVAMGAVIKHSSDWNLGREATLSSGLS 84 
172040815  82 NTTPAMDMQMACGTGLAAIVAVGDAIRAGRIESGIGSGVDTTSDAPLAVGDQLRKTLIKLTQAKTTQQRLKLVGSIRPA- 160
146301065  83 PATPACDLQQACDTGIESAVYIANKIALGQIESGIAGGVDSISDIPMAVSEKLRKVLLEARQAKSLGGKIKAFLKLSPK- 161
84625515   85 PLTPGITLQRACGTSLDSVITIANKIALGQIDSGIGGGSDTTSEVPIVYGKKLRARLLAANRVKATGDKLKTLLRGFKLg 164
188575023  49 PLTPGITLQRACGTSLDSVITIANKIALGQIDSGIGGGSDTTSEVPIVYGKKLRARLLAANRVKATGDKLKTLLRGFKLg 128
285019846  91 PLTPGITLQRACGTSLDSIIAVANKIALGQIESGIGGGSDTTSEVPIVYGKKLRARLLAAHRAKTAGDKLRVLTRSFKFa 170
42523542   83 PHTPGYDVQRACGTGLETVAQIALKIASGQIESGIGGGTDTNSDIAGVLPHEFSWIMMEAQKEKTLGGRLKKFAELKLQ- 161
120554933  94 PETPAYDIQQACGTGLEAAILVANKIALGQIECGIAGGTDTTSDAPIGVGEGLREILLDLNRAKTTKERLKILGRFRPS- 172
304312828  82 PETPAYDIQQACGTGLEAAILVANKIALGQIDCGIAGGSDTTSDAPIGISEGLRSILLEMNRAKTNADRLKALARFRPQ- 160
194363906  85 PLTPGITLQRACGTSLDSIITVANKIALGQIESGIGGGSDTTSDVPIVYGKKLRARLLAANRAKSTGDKIRALTAGFKFs 164
190572243  85 PLTPGITLQRACGTSLDSIITVANKIALGQIESGIGGGSDTTSDVPIVYGKKLRARLLAANRAKSTGDKIRALTSGFKFs 164
172040815 161 QLAPDQPSNGEPRTGLSMGDHAAITAREMNITREEQDEFAATSHQNLAKAYDEGFFEDLITPYLGVQRDTNLRPDSTPEK 240
146301065 162 DLSPLVPKNEEQQTGLSMGGHTEITAKYYKISREDQDNFALKSHLNMAKAYDEGFFNDMITPFNGLEKDNNLRKDSSIEK 241
84625515  165 ELKPEFPGVAEPRTGKSMGDHCEDMAKEWNISRDSQDEWAVASHHKLAAAYERGFFDALIAPFRGVSRDNILRADTSLEK 244
188575023 129 ELKPEFPGVAEPRTGKSMGDHCEDMAKEWNISRDSQDEWAVASHHKLAAAYERGFFDALIAPFRGVSRDNILRADTSLEK 208
285019846 171 ELKPEFPGVVEPRTGKSMGEHCEDMAKQWSIARDSQDAWAVSSHKKLAAAYARGFFADLIVPFRGVERDNILRADTSLEK 250
42523542  162 YLKPRFPNVQEPRTGKSMGDHTEMMVKDWMITREAQDELAYHSHQNAAKAYAEGFYKDLVFDFKGLKQDIFVRPDTTLEK 241
120554933 173 HLVPEIPENGEPRTGMSMGDHCQVTAKEWSIAREDQDRLAWESHQKLAKAYEEGFFDDLMTPMAGLDKDNILRPDTTLEK 252
304312828 161 HLMPLIPNNGEPRTGLSMGDHCEITAKEWDIKREDEDRLAYESHTKMAKAYDEGFFADMITPYQGLARDNNLRGDTTIEK 240
194363906 165 ELKPEFPGVAEPRTGKSMGDHCEDMAKEWNISRDSQDEWAVSSHKKLAAAYERGFFSDLIAPFRGVERDNILRADTSLEK 244
190572243 165 ELKPEFPGVAEPRTGKSMGDHCEDMAKEWNISRDSQDEWAVSSHKKLAAAYERGFFNDLIAPFRGVERDNILRPDTSLEK 244
172040815 241 LAKLKPVFGKrdaaqhGTTATMTAGNSTPLTDGASAVLLSSEEWAKERNLPVRAYLVDSEVASVDFLHGhdgktpDGLLM 320
146301065 242 LAKLKPAFDKv-------nGTLTAGNSTPLTDGASCILLASEEWAKERGLPILAYITFAEAAAIEYVKNq-----QNLLL 309
84625515  245 LATLRPAFDKt-----SGRGTLTAANSTALTDGAAAVLLSSEAWALAHGHTPMAYLRDAQVAAVDFVHG------QGLLM 313
188575023 209 LATLRPAFDKt-----SGRGTLTAANSTALTDGAAAVLLSSEVWALAHGHTPMAYLRDAQVAAVDFVHG------QGLLM 277
285019846 251 LATLKPAFDKv----sGR-GTLTAANSTPLTDGAAAVLLASEEWARAHDHAPMAYLRDVQVSAVDFVHG------EGLLM 319
42523542  242 LAKLKPAFDF------NGTGTLTAGNSTPLTDGASAVLLGSEEFAKEKNLPVLAYFVDADYAAVDFVKG------EGLLM 309
120554933 253 LATLKPCFDRe-------nGTMTAANSTALTDGASAVLLASEEWAKAHNMDVKAWLNFSEVAAVDFVDKk-----EGLLM 320
304312828 241 LASLKPCFDRe-------nGTLTAANSTPLTDGASCVLLASEEWAAQRGLPVLAYLSFSEVAAVDFVGKk-----EGLLI 308
194363906 245 LATLKPAFDKv----sGR-GTLTAANSTPLTDGAAAVLLASEEWARAHGHEPQAYLRDAHVSAVDFVHG------EGLLM 313
190572243 245 LATLKPAFDKv----sGR-GTLTAANSTPLTDGAAAVLLASEEWARAHGHEPQAYLRDAHVSAVDFVHG------EGLLM 313
172040815 321 SPTYAVPRMLERNGLTLQDFDFYEIHEAFASQTLATLKAWESEEYCRERLGLDKPLGAIDRSKLNVKGSSLAAGHPFAAT 400
146301065 310 APLFAASRMLEKAELNLQDFDYYEIHEAFAAQVLATLKIWESPELSAE-LGLKKTLGAIDREKLNVKGSSLAAAHPFAAT 388
84625515  314 APTIAVPQMLARQGLTLQDFDIYEIHEAFAAQVLCTLRAWESEDYCRNRLGLDAPLGRIDPDKINPLGSSLATGHPFAAT 393
188575023 278 APTIAVPQMLARQGLTLQDFDIYEIHEAFAAQVLCTLRAWESEDYCRNRLGLDAPLGRIDPDKINPLGSSLATGHPFAAT 357
285019846 320 APTVAVPEMLKRQGLNLQDFDIYEIHEAFAAQVLCTLRAWESEDYCRTRLGLDAPLGQIDPAKINPLGSSLATGHPFAAT 399
42523542  310 APTRAVANLLRRNNLTLQDFDFYEIHEAFAGQVLCTLKAWEDEEYCRTQLGWSKALGSIDRSKMNVKGGSLALGHPFAAT 389
120554933 321 APAYAVPRMLERAGLTLQDFDFYEIHEAFAAQVLSTLKAWEDPGFCRERLGLEKPLGTIDRDKLNVKGSSLATGHPFAAT 400
304312828 309 APAYAVPRMLDRAGLTLQDFDFYEIHEAFAAQVLYTLKAWETESFCKEKLGRNSVLGSIDRSKLNVKGSSLAAGHPFAAT 388
194363906 314 APTVAVPEMLKRNGLTLQDFDIYEIHEAFAAQVLCTLRAWESEDYCRNRLGLDAPMGRIDPDKINLLGSSLATGHPFAAT 393
190572243 314 APTVAVPEMLKRNGLTLQDFDIYEIHEAFAAQVLCTLRAWESEDYCRNRLGLDAPMGRIDPDKINLLGSSLATGHPFAAT 393
172040815 401 GGRIIATTAKLLEEnGGGRALVSICAAGGQGIVAIVER 438
146301065 389 GGRIIGVMAKLLNEkGSGRGFVSICAAGGQGVTMIIEK 426
84625515  394 GARVVATAAKQLEErGGGRALISICTAGGMGVVAIVER 431
188575023 358 GARVVATAAKQLEErGGGRALISICTAGGMGVVAIVER 395
285019846 400 GARIVATVAKQLVErGGGRALISICTAGGMGVVAIVER 437
42523542  390 GGRIVASLAKMLAQkGSGRGLISICTAGGMGVAAIIER 427
120554933 401 GGRIVATLAKLLEQkGSGRGLISICAAGGQGVTAILER 438
304312828 389 GGRIIHTAAKLLAEkGKGRALISICAAGGQGVTAILER 426
194363906 394 GARVIATAAKQLAErGGGRALVSICTAGGMGVVAIVER 431
190572243 394 GARVIATAAKQLAErGGGRALVSICTAGGMGVVAIVER 431
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap