Conserved Protein Domain Family
PRK09228

?
PRK09228: PRK09228 
guanine deaminase; Provisional
Statistics
?
PSSM-Id: 236419
View PSSM: PRK09228
Aligned: 180 rows
Threshold Bit Score: 580.609
Threshold Setting Gi: 297625058
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27378991    1 MTTVGIRGTFFDFVDDPWKhiGNEQAAARFHQDGLMVV-TDG-VIKAFGPYEKIA----AAHPG-VEITHIKDRIIVPGF 73
gi 239906177   3 GGHCAIRGTFFDFLDDPWKhvGQEQDAARFIADGLLVV-KDG-RIEDFGPFTEVS----ARRPG-LEVTHLPGRILMPGF 75
gi 15807848    1 --MKIYRSTLLHTPASPFA----VPDALQTFSDGALAVgDTG-TIAHLGTFTEVLaevrAACPD-AEVHDLRGGVLLPGF 72
gi 94972074    4 GQVTLYRATFMHTPASPFT----APDTLQIQEDGALLV-EDG-RILAGGPYAQVR----AAQPR-AEVVDLRGGVLLPGF 72
gi 258650519   1 --MTLYRATIVDTPGDPFA--GDPADALATDPDGGLLV-IDG-VIRERGPFAALR----ADHPDe-PLVELTGGLLLPGF 69
gi 258650758   1 MATTAVRGTFLDFVDDPWRhvGAEQESARFHADGLLVI-SDG-RVADFGPYAEVR----ARHPQ-VPVTEIADRLILPGF 73
gi 297566209   4 AMTRIIRGVLMHAPSSPFH-----GPGLEAFSDGGLAI-QGG-RIVAVGAFVEVR----GQYPD-AEVSDLREGVILPGF 71
gi 291295846   1 -MTVLLRGLILHTPHNPFH----TAGALEAFSDGGLAL-RDG-QIVALGSFSEVR----KHHPE-APVQDCREGVLLPGL 68
gi 297625058   4 GMLTLLRARLFHTPKNPFT----EAGALEAFSDGALVI--DGeRIVAVGDAATLR----GRY-QsAALAGDPESYLLPGF 72
gi 56478079    2 SGLRAIRGEIVHFLGDPAD---LGADALAHFPDGLLIV-RDG-LVAELGPAADLL----PRLPAgTTVDDYRGKLVLPGF 72
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27378991   74 IDGHIHLPQTRVLGAYGEQLLPWLQKSIYPEEIKYKDRNYAREGVKRFLDALLAAGTTTCQAFTSSSPVATEELFEEASR 153
gi 239906177  76 IDGHIHFPQTRVLGAYGNQLLDWLQNSIFLEELKYNDRDYASQAAEHFFTALLAGGTTTCQAFTTSSPVSTEVFFEEAAK 155
gi 15807848   73 IDTHVHYPQVRVLGGLGMALLEWLDRNTLPEEARLADAAYARTIAGEFLHGLASHGTTTALVFGSHFAGAMDEFFAEAAA 152
gi 94972074   73 IDTHVHYPQVRVLGGLGMGLLEWLDRNTLPEEARLSDPVYARAVAREFLSALASNGTTTALVFGSHYASAMDVFFEEAAR 152
gi 258650519  70 VDTHVHYPQLRAIGGLGMPLLDWLEQCALPEESRLAEPEYAAPLAQEFVSELIAHGTTTALVFGSHFESAMDILFAAGQD 149
gi 258650758  74 VDGHIHFPQTRVLGAYGEQLLPWLQKSVFPEERKYADREYAQLGGQHFFDNLLASGTTTIQAFTSSAPVCTEELFLEATR 153
gi 297566209  72 VDLHVHYPQARIIGALGYRLLDWLEDHTLPEEARLADVTYARALAKDFLRGLLKNGTTTALVFGSHFAAAMEVFFEEALA 151
gi 291295846  69 VDTHVHYPQTRVIGAMGYSLLDWLEKRTLPLEARLSDNRLARELAREFVWLLLRNGTTTALVFGSHFQGATANLFGAAED 148
gi 297625058  73 VDTHVHYPQVRVIGAMGLTLLDWLRERTLPEEARLADLAYARALAARFVRALLRNGTTTALVFGSHFPGAQEALFEEAER 152
gi 56478079   73 IDTHIHYAQTDIVASYGEQVLAWLEKYTYPTERRFADPAHAAAVAEFFCDELLRNGTTTAMAFATVHPASVDALFAAARK 152
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27378991  154 RNMRVIAGLTGIDRNAPAEFIDTPENFYRDSKRLIAQYHDKGRNLYAITPRFAFGASPELLKACQRLK-------HEHPD 226
gi 239906177 156 RNMRVISGLTGIDRFAPPEVVISPDDFYKESKRLIERYHRRGRNLYAITPRFAVGCTDAMMDRCRQLK-------EEHPD 228
gi 15807848  153 RGLRVVAGQVVSDRLLRPELHTTPERAYAEGKALIERWHGQGRSLYAVTPRFSLSASEGILDACAALL-------TEFPD 225
gi 94972074  153 TGLRVVAGQVVSDRLLRPELHTTPERAYAEGKALIERWHGVGRALYAVTPRFALSASEGILDACGALM-------RECEG 225
gi 258650519 150 AGLNLTTGLVLSDRILRPDLLCSPADALAASQRLIDRWHGKGRLRYAVTPRFSLSTTDEMLEVCRQLLgpgsdrdAHAAD 229
gi 258650758 154 RNLRVISGITAIDQNAPDWFTISPADFEAAAKDQIARFHRQGRNLYAITPRFAFGATEELFRTCQRLK-------HEYPD 226
gi 297566209 152 SGLRILAGLVLSDRNLRPELHTTPQRAYQESLSLARKWHERGKLRYVVTPRFSLSCSEAILEVCQQIQ-------KELPG 224
gi 291295846 149 VGLRIIAGQVCSDRMLRPELHTTPERSYAEQKMLIQRFHGRGRLRYAVTPRFALSASEGLLEVCQALL-------QEHPD 221
gi 297625058 153 VGLRLTSGLVLADRLLRPELHTDPETAYRTCETLISRWHGRSRLRYALTPRFALSCSDALLEVTGALL-------RAYPD 225
gi 56478079  153 RHMRMIAGKVLMDRNCPDFLRDPADGGDAESKALIERWHGRDRLLYAVTPRFAPTSTPAQMALAGRLF-------ADHPG 225
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27378991  227 CWVNTHISENPAECSGVLVEHPDCQDYLGVYEKFDLVGPKFSGGHGVYLSNNEFRRMSKKGAAVVFCPCSNLFLGSGLFR 306
gi 239906177 229 CWINTHISENPSEIRTAREHYPDCPDYTSVHEKHGLLGPKFTAGHGVWLSGDEMRRFSKAGAAISFCPLSNLFLGSGLFR 308
gi 15807848  226 VRFTSHINENNQEIEVVRGLFPGARDYLDTYERAGLVTPRSVFAHNVHPNERELGVLAAQRCSVAHCPCSNSALGSGLFP 305
gi 94972074  226 VRFTSHINENPREIETVLQLFPGARDYLDPYERAGLVTRRSVLAHNVHPTDRELSVMAAHHCSAAHCPCSNAALGSGLFP 305
gi 258650519 230 IWFTSHVNENLAEVQTVADLFPGTAHYIDTYHRHGLVTDRSVFAHNVHPTDHELDLMAQAGAWAAHCPTSNSALGSGLFP 309
gi 258650758 227 LWVHTHISENPAEVRGVPPLHPGCTDYLSVYEKFDLVGPKFTGGHGVWLTNDEFRRLSASGGAVTFCPCSNLYLGSGLFR 306
gi 297566209 225 TFFTSHLNEMPEEIATVRKLFPWADSYCQTYDRFGLVGGHAVFAHNVYPQDAELECLASYRSAVAHCPCSNAFIGSGIFP 304
gi 291295846 222 LHFTTHINENLEEIRTVAELFPWSQHYLHTYDRFGLVTERSVFAHNVHPTEPELARLAEARAAIAHCPSSNAFIGSGIFP 301
gi 297625058 226 VWFQTHLNESRDEIRTVAELFPWAEDYLATYERFGLVGARSVFAHNVHVREGELRRLAAAGSAVAHCPSSNMFIGSGLFS 305
gi 56478079  226 VYLQSHLAENEREVAWVARLYPEARSYLDVYERYGQLGARSVFAHCVWIDDTDRTRLAATGAAISFCPTSNLFLGSGLFD 305
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27378991  307 LGRATDPEhrVKMSFGTDVGGGNRFSMISVLDDAYKVgmcnntlldgsidpsrKDLaeaERNKLSPYRGFWSVTLGGAEG 386
gi 239906177 309 LGRAKDPDhpVRLSVGSDMGGGNAFSLVRVLEEAYKVgmcnntmldgsvnpreQDLaeaERNKLSPYRAFYLATLGGANS 388
gi 15807848  306 LRRHLAAG--VHVALGTDVGGGTGFSLLKEGLQAYFM----------------QQLlgeEGAALSPAHLLYLATLAGAQA 367
gi 94972074  306 LRRHLQAG--VHVSLGTDVGGGTGFSMLKEGLQAYFM----------------QQLlgsAGAVLGPAELLYLATRAGAEA 367
gi 258650519 310 LARHVRHG--VGVALGSDVGAGTGLFLPKEGLQAYFM----------------QQLlgaQGLPLTPVHLLYLATHAGARA 371
gi 258650758 307 LGRATDPEhrVKLTFGTDMGGGNRFSMLNVLEDAYKVgmlnntlldgsvvpseQDLaesERNKLSPYRAFYSITLGGAQA 386
gi 297566209 305 LRRHLEAG--VKFGLGTDVAGGTGFGILKEGLMAYLT----------------QRLl-pEGYLLTAPQLLYLATRAGAEA 365
gi 291295846 302 MNRHLRHG--VRFGLGSDVGGGTGFSLLKEGLMAYLA----------------QRYa-pEGVGLTPAHLLYLATQAGAEV 362
gi 297625058 306 LRRHLACG--VRVALGSDVGGGTGFSLLKEGLMAYQG----------------QMLq-pDGVPLGPAHLLYLATRAGALA 366
gi 56478079  306 LDRAHAAG--VRVGLGTDVGGGTSFSMLQTLNEAYKV----------------QQL---RGQRLPVERGFYLATRGGARS 364
                        410       420       430       440       450       460       470
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 27378991  387 LYIDDKLGNFEPGKEADFVALDPNGGQLAQPWHQSliadgagprtVDEAASMLFAVMMVGDDRCVDETWVMGKRLYKKS 465
gi 239906177 389 LYLDDILGNFEPGKEADFVALDWNAGQAAMAWHQSlavgdggpetMEQAAKLLFGIMAVGDDRNVDETWVAGRRLYKKA 467
gi 15807848  368 LGLDGQVGDFTPGKQFDAVWLRPRAGSTLATVLAH----------AESEERTLAALFALGTGDDVERVWVGGGVVFARE 436
gi 94972074  368 LDLQDLTGDFGVGKAFDAVYLRPPEGTTLATVLRH----------ADSSARVLAALFTLGTGQDVAQVWVGGDSVYRRA 436
gi 258650519 372 LGLADRVGTLTVGRDFDAVWLRPEPSSSLGINLRQ----------AADPTDALARVFALSTPHDVAGVWLRGEPAYTR- 439
gi 258650758 387 LEIDDLVGNFDVGKEADFVVLDWNGGPPATAWHMSlllpdgaprtMQDAAEVLFGIMMVGDERAVEQTWLMGERAYRKP 465
gi 297566209 366 LSLQDEIGDFGIDKAADLVYVKPPRGSSLEAVLRH----------AETPEQVLGAVFTMASEADIAEVFVDGEERLM-- 432
gi 291295846 363 LGLGETVGSLTPGKAADVIWVRPEPGSTLEVHFRH----------LDSAEDLLGSLFTLHGEAQVHRVWLEGREVMVS- 430
gi 297625058 367 LGQEA-LGDLSPGRQADLVLLKPPPGSTLEEVLRH----------SPSPEASLGALFTLAREESVRDVWVAGVSLRAHL 434
gi 56478079  365 LYLDDRIGSFDTGREADLVVLDPAATPLLARRTAV----------ATTLAERLFALMLLGDDRAVAATWVMGEPAWRRP 433
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap