Conserved Protein Domain Family
PRK09185

?
PRK09185: PRK09185 
3-oxoacyl-(acyl carrier protein) synthase I; Reviewed
Statistics
?
PSSM-Id: 236398
View PSSM: PRK09185
Aligned: 122 rows
Threshold Bit Score: 508.613
Threshold Setting Gi: 56459251
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
300705215   1 MKPLLLSHFTATSCLGRGVDATLDALRGQRGGLAPCRFERADLDTWTGAVDGVDaQSVRADLRDFECRNNRLAQIGLTQd 80 
53804751    1 MVPILISAFTVTSSLGCGQESTFHALTNGECGLIPCRFETVALNTFVGEVAGVDrVVIPPGLSAFDCRNNRLALLGLTQd 80 
206559231   1 MNPLLLSHFTATSCIGRGLDATLDALRRARGGLVPCNFERADLDTWIGAVDGVDaHPVRADLADFECRNNRLAQLGLTQd 80 
107023699  17 VNPLLLSHFTATSCIGRGLDATLDALRHARSGLVPCNFERADLDTWIGAVNGVDaQPVRADLADFDCRNNRLAQLGLTQd 96 
116690786  17 VNPLLLSHFTATSCIGRGLDATLDALRHARSGLVPCNFERADLDTWIGAVNGVDaQPVRADLADFDCRNNRLAQLGLTQd 96 
115352869   1 MKPLLLSHFTATSCIGRGLDATLDALRHARGALTPCDFERAELDTWIGSVDGVDaQPVRADLSDFDCRNNRLAQLGLVQd 80 
172061726   1 MKPLLLSHFTATSCIGRGLGATLDALRHARGALTPCDFERAELDTWIGSVDGVDaQPVRADLADFDCRNNRLAQLGLVQd 80 
73537761   18 VSPLHLSHFTATSCIGTGLDDTVSALREQRGGLAPCQFGDIRLDTWVGEVPGVDsVTLPPGLADFACRNNSLALLALEQd 97 
194292221   1 MSPLLFSHFTATSCLGAGIDATLAALRAQRGGLAPCQFGDVALDTFVGEVDGLDaVTLPAGLSEFDCRNNRLAQLALEQd 80 
116695606   1 MSPLLFSHFTATSCLGAGVDATLSALRAQRGGLAPCRFGGVELDTFVGEVPGLDtVALPPALAEFDCRNNRLAQLALEQd 80 
300705215  81 gFAEHVEAAKARHGAARIGVFMGTSTAGILETELAYRHRDPqtgaLPADFHYAQtHSPYACAAFVRAYCGLRGPAMSVSS 160
53804751   81 gFADAVRGAVGRFGTRRIGVFIGTSTSGMLETELAYRRRDPdsgaLPADFDYGGtHNCFSAGAFVRAYFGIEGPAVVVSS 160
206559231  81 gFDARVAAAAARYGAARIGVFVGTSTAGILETERAYQRRDPssgaLPADFRYAHtHNPYSPAAFVRAYFALRGPAMAISS 160
107023699  97 gFDARVAAAVARYGAARVGVFVGTSTAGILETERAYQRRDPasgaLPADFRYAHtHNPYSPAAFVRAYFALRGPAMAISS 176
116690786  97 gFDARVAAAVARYGAARVGVFVGTSTAGILETERAYQRRDPasgaLPADFRYAHtHNPYSPAAFVRAYFALRGPAMAISS 176
115352869  81 gFDARVAAAVSRHGAARVGVFIGTSTSGILETERAYEQRDPasgaLPAGFRYAHtHNPYSAAAFVRAYFSLRGPATAISS 160
172061726  81 gFDARVAAAVSRHGAARVGVFIGTSTSGILETERAYEQRDPasgaLPAGFRYAHtHNPYSPAAFVRAYFGLRGPAMAISS 160
73537761   98 gFADRVREAVARYGADRIGVFLGTSTAGVLQTELAYRQRDPqtgaLPAGLSYAGtHSPYSLPGFVRAYFGLQGPANAVSS 177
194292221  81 gFAARVREAAARYGAHRIGVFLGTSTAGVLQTELGYRQRDPasgaLPPDFHYGGtHNPYSLPAFLRQQLGLSGPAAAVSS 160
116695606  81 gFAARVREAAARYGAHRVGVFLGTSTAGVLQTELAYRQRDPasgaLPPGFHYATtHNPYSLPAFLRQYLGLTGPAAAVSS 160
300705215 161 ACSSGAKVFGSARRMLEAGLIDAAIVGGVDSLCLTTLYGFNSLELLSRQPCKPFDVARDGISIGEAAAFVLLERAddrsr 240
53804751  161 ACSSSAKVFGNAARMIQAGLIDAAVVGGVDSLCLTTLYGFNSLELLSPRPCRPFDARRDGISIGEAAAFALLQRTpd--- 237
206559231 161 ACSSGAKAFGSARRMIEAGLIDAAVVGGVDSLCLTTLYGFNSLELLSRRPCRPFDTARDGISIGEAAAFALVERVpdpp- 239
107023699 177 ACSSGAKVFGSARRMIEAGLIDAAVVGGVDSLCLTTLYGFNSLELLSRQPCRPFDVARDGISIGEAAAFALVERVpapp- 255
116690786 177 ACSSGAKVFGSARRMIEAGLIDAAVVGGVDSLCLTTLYGFNSLELLSRQPCRPFDVARDGISIGEAAAFALVERVpapp- 255
115352869 161 ACSSGAKVFGSARRMIEAGLIDAAVVGGVDSLCLTTLYGFNSLELLSRKPCRPFDVARDGISIGEAAAFALLERVpetr- 239
172061726 161 ACSSGAKVFGSARRMIEAGLIDAAVVGGVDSLCLTTLYGFNSLELLSRQPCRPFDVARDGISIGEAAAFALLERVpdar- 239
73537761  178 ACSSGAKVFTSARRLIEAGLIDAAVVGGVDSLCHTTLYGFGSLELLSNQPCRPFDADRNGISIGEAAAFVLVERTpd--- 254
194292221 161 ACSSGAKVFSSARRMLEAGLIDAAVVGGVDSLCHTTLYGFNALELLSRQPCRPYDVARNGISIGEGAAFGLLERVtg--- 237
116695606 161 ACSSGAKVFSSARRMLEAGLIDVAVVGGVDSLCHTTLYGFNSLELLSDQPCRPYDVARNGISIGEGAAFGLLERVag--- 237
300705215 241 qgqgqalGDDAILLLGIGESSDAHHMSTPHPEGLGARLAMEQALASAGIAAGEIDYINLHGTATASNDAAESCAVNALF- 319
53804751  238 -----daGSDALFLLGIGESSDAHHMSAPHPEGLGAKAAIGAALASAGLSPARIGYVNLHGTGTRANDAAEALAVQAVFg 312
206559231 240 ----aalDDDAILLLGIGESSDAHHMSSPHPEGLGARAAIEQALASAGLGAHDIDYVNLHGTATPSNDAAESRALGALF- 314
107023699 256 ----atlDADAILLLGIGESSDAHHMSSPHPEGLGARAAIEQALASAGLDAHDIDYVNLHGTATPSNDAAESRALGALF- 330
116690786 256 ----atlDADAILLLGIGESSDAHHMSSPHPEGLGARAAIEQALASAGLDAHDIDYVNLHGTATPSNDAAESRALGALF- 330
115352869 240 ----aalDGDAILLLGVGESSDAHHMSSPHPDGLGARVAIEQALASAGLDASDIDYVNLHGTATPSNDAAESRAVGALL- 314
172061726 240 ----talDDDAILLLGVGESSDAHHMSSPHPDGLGARVAIEQALASAGLNASDIDYVNLHGTATPSNDAAESRAVGALL- 314
73537761  255 -----paPDGAILLLGIGESSDAHHMSAPHPEGLGASMAMEQALTRAGVSPEQVDYVNLHGTATRANDATEARAISALL- 328
194292221 238 -----pvADDAILLAGIGESSDAHHMSTPHPQGLGARMAMAQALAGAGIAPAQVGYVNLHGTATRSNDAAEALAMAAVL- 311
116695606 238 -----saQGDAILLAGIGESSDAHHMSTPHPDGLGARLALEQALASAGVAPAQVGYVNLHGTATRSNDAAEAMAMAAVL- 311
300705215 320 SGTPCSSTKGATGHTLGAAGALEAVIAALALRHQLLPAGINTTRLDPALALDYVLTSRPARVRTALSNAFGFGGTNCSLV 399
53804751  313 NAVACSSTKGSTGHTLGAAGAVEAVISLLAIRHGFMPAGVNTGILERGFELDYVRSSRHARLEAVLSNSFGFGGSNCALV 392
206559231 315 ARTPCSSTKGATGHTLGAAGALEAIVAALALQEQFVPAGVNTTQPDPALVADYVLASRDTRVRAVLSNSFGFGGTNCSLI 394
107023699 331 ARTPCSSTKGATGHTLGAAGALEAIVAALALREQFVPAGVNTTQPDPALVADYVLASRDTRVRAVLSNSFGFGGTNCSLI 410
116690786 331 ARTPCSSTKGATGHTLGAAGALEAIVAALALREQFVPAGVNTTQPDPALVADYVLASRDTRVRAVLSNSFGFGGTNCSLI 410
115352869 315 ARTPCSSTKGATGHTLGAAGALEAVVAALALREQFVPAGVNTTQPDPALAADYVLASRDAHLRAVLSNSFGFGGTNCSLI 394
172061726 315 ARTPCSSTKGATGHTLGAAGALEAVVAALALREQFVPAGVNTTQPDPALAADYVLASRDAHLRAVLSNSFGFGGTNCSLI 394
73537761  329 PGTPCSSTKGATGHTLGAAGALEAVISALALRHGLLPAGINTTQIDPALAVDYCLATREQPLRHVLSNAFGFGGSNCSLL 408
194292221 312 PGTPCSSTKGATGHALGAAGALEAVICALALRHGLVPAGINTAQVDPALDVNYQLANRDTPLRYAMSNAFGFGGSNCSLL 391
116695606 312 PGTPCSSTKGATGHALGAAGALEAVICALALRHGLMPGGINTTQVDPALDVNYQLANREAPLRYAMTNAFGFGGSNCSLL 391
300705215 400 LGRA 403
53804751  393 FGRP 396
206559231 395 LGRA 398
107023699 411 LGRA 414
116690786 411 LGRA 414
115352869 395 LGRA 398
172061726 395 LGRA 398
73537761  409 LGRA 412
194292221 392 FARA 395
116695606 392 FARA 395
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap