Conserved Protein Domain Family
PRK09116

?
PRK09116: PRK09116 
3-oxoacyl-(acyl carrier protein) synthase II; Reviewed
Statistics
?
PSSM-Id: 181657
View PSSM: PRK09116
Aligned: 83 rows
Threshold Bit Score: 569.62
Threshold Setting Gi: 161870548
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
15677551    4 TRRVAVTGIGGITAFGRDWQSIQAAFKAEKNAVKYMDWHERFPELEAQLGAPIENYAPPKHWTRKQLRSMGRVSYLCVDA 83 
77456650    1 MKRVVVTGMAGITSLGSDWDTIAGNFAANRSGIRRMDEWDRFSELNTRLAGPIDDFQVPAHWTRKQLRSMGRVSRLAVGA 80 
229587979   1 MKRVVVTGMAGMTSLGGDWETISANFRANRSGIRRMDEWDRFTELNTRLAGPIDDFVVPAHWTRKQLRSMGRVSRLAVWA 80 
70733965    1 MKRVVVTGMAGITSLGSDWASIAERFAANRSGIRRMDEWDRFSELNTRLAGPIDDFQVPGHWTRKQLRSMGRVSRLAVGA 80 
71734424    1 MKRVVVTGMSGITSVGSDWPTIDASFIANRSGIRRMDEWNRFAELNTRLAGPIDDFAVPAHWTRKQLRSMGRVSRLAVAA 80 
66043689    1 MKRVVVTGMSGITSVGSDWPTIDARFTANRSGIRRMDEWNRFAELNTRLAGPIDDFAVPGHWTRKQLRSMGRVSRLAVAA 80 
28872223    1 MKRVVVTGMSGITSVGSDWATINASFTANRSGIRRMDEWDRFIELNTRLAGPIDDFAVPAHWTRKQLRSMGRVSRLAVGA 80 
121635339   1 ----------------MDWH-------------------ERFPELEAQLGAPIENYAPPKHWTRKQLRSMGRVSYLCVDA 45 
161870548   1 ---------------------------------------------------------------------MGRVSYLCVDA 11 
163858759   1 MERVVVTGMGGLCALGDQWDQIEAAMNAGRNAVRVMPDWDRYTELNTRLAAPLPAFSPPSHWTRKQLRSMGRVSQLAVCA 80 
15677551   84 AEQALADAGLLGDESITDGRMGVACGSSSGSTKDIGDVGELLLTGTSRNFSANTYVRMMPHTTAANIGIFFGLKGRIIPT 163
77456650   81 AEKALADAGLLGDESIKDGRMGVACGSSTGSTDEIKAFGNMLLNSVAEGLNANSYVRMMPHTTAANISIFFGLTGRLIPT 160
229587979  81 AEQALRDAGLLGDESIKDGRMGVACGSSTGSTDEIKAFGNMLLNSVAEGLNANSYVRMMPHTTAANISIFFGLTGRLIPT 160
70733965   81 AEQALADAGLLGDPSIKDGRMGVACGSSTGSTDEIKAFGNMLLNSVAEGLNANSYVRMMPHTTAANISIFFGLTGRLIPT 160
71734424   81 AEQALIDAGLLNDPLIRDGRMGTACGSSTGSTDEIKAFGNMLINSVAVGLNANSYVRMMPHTTAANISIFFGLTGRLIPT 160
66043689   81 AEQALIDAGLLNDPIIRDGRMGTACGSSTGSTDEIKAFGNMLINSVAVGLNANSYVRMMPHTTAANISIFFGLTGRLIPT 160
28872223   81 GEQALIDAGLLNDPIIRDGRMGTACGSSTGSTDEIKAFGNMLINSVALNLNANSYVRMMPHTTAANLSIFFGLTGRLIPT 160
121635339  46 AEQALTDAGLLGDESITDGRMGVACGSSSGSTKDIGDVGELLLTGMSRNFSANTYVRMMPHTAAANIGIFFGLKGRIIPT 125
161870548  12 AEQALADAGLLGDESITDGRMGVACGSSSGSTKDIGDVGELLLTGTSRNFSANTYVRMMPYTAAANIGIFFGLKGRIIPT 91 
163858759  81 AERALADAGLLGDESISDGRMGVACGSSTGSTAEVRAFGNMLLNGVTDDLNANSYVRMMPHTTAANIGIFFSLKGRVIPT 160
15677551  164 SSACSSGSQGIGYAYEAIKYGLTDMMLAGGGEEFFPSEVYVFDSLYAASRRNGEPEKTPRPYDANRDGLVIGEGAGIFVL 243
77456650  161 SSACTSGSQGIGYAYEAIKFGRLPLMLAGGAEELCPTEAMVFDALYATSLKNDAPHTSPRPYDKDRDGLVIGEGGGMLVL 240
229587979 161 SSACTSGSQGIGYAYEAIKFGRLPLMLAGGAEELCPTEAMVFDALYATSLKNDAPQTSPRPYDSGRDGLVIGEGGGMLVL 240
70733965  161 SSACTSGSQGIGYAYEAIKFGRLPLMLAGGAEELCPTEAMVFDALYATSLKNDAPHTSPRPYDSGRDGLVIGEGGGMLVL 240
71734424  161 SSACTSGSQGIGYAYESIKFGRLPLMLAGGAEELCPTEAMVFDALYATSLKNDAPHTTPRPYDSGRDGLVIGEGGGMLVL 240
66043689  161 SSACTSGSQGIGYAYEAIKFGRLPLMLAGGAEELCPTEAMVFDALYATSLKNDAPHTTPRPYDSGRDGLVIGEGGGMLVL 240
28872223  161 SSACTSGSQGIGYAYEAIKFGRLPLMLAGGAEELCPTEAMVFDALYATSLKNDAPHTTPRPYDSGRDGLVIGEGGGMLVL 240
121635339 126 SSACSSGSQGIGYAYEAIKYGLTDMMLAGGGEEFFPSEVYVFDSLYAASRRNGEPEKTPRPYDANRDGLVIGEGAGIFVL 205
161870548  92 SSACSSGSQGIGYAYEAIKYGLTDMMLAGGGEEFFPSEVYVFDSLYAASRRNGEPEKTPRPYDANRDGLVIGEGAGIFVL 171
163858759 161 SSACTSGSQGIGYAFEAIRYGRQALMLAGGAEELCPSEAIVFDALYATSQKNHAPELTPRPYDRSRDGLVIGEGAGMLVL 240
15677551  244 EELEHAKRRGAIIYAELVGYGANSDAYHISTPRPDAQGaiLAFQTALQHANLAPEDIGWINLHGTGTHHNDNMESRAVAA 323
77456650  241 EELEHALARGAHIHAEIVGFGSNADGQHTTRPEQITMR--RAMELALEDAGLAPDVIGYVNGHGTATEQGDVAETLATSA 318
229587979 241 EELEHALARGAHIHAEIVGFGSNADGQHTTRPEQKTMR--RAMELALEDAGLEPSAIGYVNGHGTATDQGDIAETLATSS 318
70733965  241 EELEHALARGARIHAEIVGFGSNADGQHTTRPEQSTMR--RAMELALEDGALAPEAIGYVNGHGTATEQGDIAETLATSS 318
71734424  241 EELEHAQARGAHIYAEIVGFGSNADGAHSTRPEQATMR--RAMELALEDANLPPDAIGYVNGHGTATEQGDIAETLATSS 318
66043689  241 EELEHAQARGAHIYAEIVGFGSNADGAHSTRPEQTTMR--RAMELALEDANLSPDAIGYVNGHGTATEQGDIAETLATSS 318
28872223  241 EELEHAQARGAHIYAEIVGFGSNADGAHSTRPEQATMR--RAMELALEDAGLPPEAIGYVNGHGTATEQGDIAETLATSS 318
121635339 206 EELEHAKRRGAKIYAELVGYGANSDAYHISTPRPDAGAi-LAFQTALQHAGLAPEDIGWINLHGTGTHHNDNMESRAVAA 284
161870548 172 EELEHAKRRGAIIYAELVGYGANSDAYHISTPRPDAQGaiLAFQTALQHAGLAPEDIGWINLHGTGTHHNDSMESRAVAA 251
163858759 241 ESLSHAQARGARIHAELVGFGCNSDGTHITRPEAVTMR--IAMAQALADAGLPPEAIGYVNGHGTATEHGDIAETLATHA 318
15677551  324 VFGNNTPCTSTKPQTGHTLGAADAIEAAFAWGIADrqsnpEGKLPPRLWDGQNDPNLPAINLTGSGSRwETEKRITASSS 403
77456650  319 LFGERMPISSQKSFLGHTLGACGALESWFSIEMLN-----RDLYVHTLNLDEVDPHCGKLDYLRGEFR-QMSHDYVMNNN 392
229587979 319 LFGSRMPISSQKSFLGHTLGACGALESWFSIEMMN-----RDQYVHTFNLHSVDPQCGELDYLQGEFR-EMHHDYVMNNN 392
70733965  319 LFGSRMPISSQKSFLGHTLGACGALESWFSIEMLN-----RDLYVHTCNLDQVDPRCGELDYLQGGFR-AMSHEYVMNNN 392
71734424  319 LFGPRMPLSSQKSFLGHTLGACGALESWFSIEMLN-----SDRYIHTLNLVDIDSQCGELDYIVGEPR-RMSNEYVMNNN 392
66043689  319 LFGPRMPLSSQKSFLGHTLGACGALESWFSIEMLN-----SDRYIHTLNLVDIDPQCGELDYIVGEPR-HMSNEYVMNNN 392
28872223  319 LFGPRMPLSSQKSFLGHTLGACGALESWFSIEMLN-----SDRYIHTLNLVDVDPHCGELDYILGEPR-QMSNEYVMNNN 392
121635339 285 VFGNNTPCTSTKPQTGHTLGAADAIEAAFAWGIANrqsnpEGKLPPRLWDGQNDPNLPAINLTGSGSRwETEKRIAASSS 364
161870548 252 VFGNNTPCTSTKPQTGHTLGAAGAIEAAFAWGIADrqsnpEGKLPPQLWDGQNDPNLPAINLTGSGSRwETEKRITASSS 331
163858759 319 LFGPRAMISSQKSYLGHTLGACGALESWFSIEMLK-----AGRYAPTLNLCDVDPLCGDLDYIMGTTR-HAEVEYVMNNN 392
15677551  404 FAFGGSNCVLIIG 416
77456650  393 FAFGGVNTSLIFR 405
229587979 393 FAFGGVNTSLIFR 405
70733965  393 FAFGGVNTSLIFR 405
71734424  393 FAFGGVNTSLIFK 405
66043689  393 FAFGGVNTSLIFR 405
28872223  393 FAFGGVNTSLIFK 405
121635339 365 FAFGGSNCVLIIG 377
161870548 332 FAFGGSNCVLIIG 344
163858759 393 FAFGGINTSLIFR 405
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap