Conserved Protein Domain Family
dnaE

?
PRK09074: dnaE (this model, PSSM-Id:103676 is obsolete)
DNA polymerase III subunit alpha; Validated
Statistics
?
PSSM-Id: 103676
View PSSM: PRK09074
Aligned: 49 rows
Threshold Bit Score: -1
Threshold Setting Gi: 0
Created: 22-Jul-2008
Updated: 31-Jul-2008
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110681190    2 STHPRFIHLRTHSEYSLLEGALRLKKLPSMCRDAGMPALALTDKNNMFAALEFSVAMSGAGVQPILGCQVDVAYVTAQPg 81
gi 148261382    1 MPHADFVHLRVHSAYSLSEGAIKPDKIATLARDNAMPAVAITDTSNLFGSIEFSQACMGKGVQPIVGCQIGLARTDLPR- 79
gi 16126169     4 AEGQGFVHLRVRSAYSLLEGAIKADQIGKLAAEAKMPAAGLADRANLFGALEYSSYAKDAGVQPIIGCAIPVVGIGGGPt 83
gi 167646770    4 SEGQGFVHLRVRSAYSLLEGAIKADKIPGLAAAAGMPAAGLVDRNNLFGALEYSVYSKDYGVQPIIGCALAVSGVGAGPt 83
gi 162148792    1 MPHADFVHLRVHSAYSLSQGAIRIPEIASLAQDMRMPAVAITDTGNLFGALEFSQYCSGKGVQPIIGCQVGLPPRNDKPg 80
gi 58038565     1 MSHADFVHLRNHSAYSLSQGAIRIPELVSLAAKNGMPAVALTDSGNLFGALEFSLYCRSNGVQPIVGCQISLPPRSTKPg 80
gi 114327944    1 MAHANFVHLRVHSAYSLSEGAIKTDKIPALARQMAMPAVAMTDSGNLFGILEFSQACAGKGVQPIIGCQIGLARPEQQQr 80
gi 83311668     1 -----------------------------------MPAVGITDTANLFGALEFSTSCSDAGIQPIVGAQIAIRREDGGPs 45
gi 114569928    2 AAQLPFVHLRVRSPYSVLEGAIRMPKMVEACQTHGMPAIALTDTNNLFGALEFSEVLSGAGVQPIVGCTLKVRLGDPHPg 81
gi 119384499    3 ENSPRFIHLRTHSEHSLLEGAVPVKKLADLAAQNGMPAVALTDSNALFAALEFSVKAQDAGVQPIIGCQVTLAA------ 76
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110681190   82 e--reRAPAPVVLLAQSEAGYENLMRLNSCLYIDK-GGALPQVTLSELESNAGGIICLTGGPDGPVGQLLQLGQMPAAQA 158
gi 148261382   80 -----LPPDPLVLLAKDATGFANLSKLSSRSFLDTePGLRPQISLDTLRDHHEGLFLLTGGRFGPVGRLLGDGQRPEAAR 154
gi 16126169    84 e--rwARAPTLMLLAQNERGYLNLSELSSIAYLDSaELPEPVVPWAKVAEHSEGLILLSGGTDGPVDALFAAGKTAEASA 161
gi 167646770   84 e--rwARTPTITLLVQNERGYLNLSELSSMAYLESgEMAEPVVPWAKVVEHAEGLILLSGGTDGPVDALLAAGKTAEGEA 161
gi 162148792   81 -----APAEPVVLLAQDETGLMNLQYLSSQGFLTG-DTAEPTVTLDVLCERAEGLILLTGGTRGPLFRMLADGQQDEVAQ 154
gi 58038565    81 -----AMSEPLVVLARNEEGLANLQILSSEGFLNG-DPADPSVAVDFLCQHAAGLFLLTGGNRGPINKLILEEQKSEAQA 154
gi 114327944   81 -----LPPDQLVLLARDEAGLANIQRLSSLGFLQGePGAKPQLPLETILAHAEGVMLLTGGTSGPLARLLAEGQKGEAER 155
gi 83311668    46 kdgrkPEPDTLVLLCQNEAGYLNLLKLVSKAFLETdAGETPQVTLHDLETRSDGLIVLTGGPAGPVGRLLADGQTEKAEI 125
gi 114569928   82 e--raEPDGTLVLLAQDEVGYGNLMALSSAAYLDVdGSEEPHIPFSLVLDHAAGLIALTGGPDGLLNRLITGGRQPEAAT 159
gi 119384499   77 -----EATGPVVLLAQNEAGWLNLMELSTCLYLRD-DHALPHVTPEELAAHAEGLICLTGGAGGPLGQLVLQGRQAEARA 150
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110681190  159 LMDRLKAAFQDRLYIELQRHPges-gqPEKERLTERGFVEMAYAMDLPLVATNDVYFPNSDMYEAHDALICIAEGAYVDQ 237
gi 148261382  155 LLAALAETFPDRLAVELERHD------LPTERAVEPGLITLADEAGLPLVATNECFFATETMHEAHDALLCIAEGRVLSE 228
gi 16126169   162 ALAEMHRVFGDRFYVELQRHG------LPRQAAAEPGLVNWAYDHDVPLVATNDVYFAKPGFYDAHDALLCISDGAFVGQ 235
gi 167646770  162 ALVEMQRAFGDRFYVELQRHG------LPRQAAAEPGLVHWAYEHDAPLVATNDVYYAKPELYDAHDALLCISDGAFVGQ 235
gi 162148792  155 WLERLHAAFGDRLAVELHRHG------LPVEKAVEPGMIALADRMGLPLVATNECFFPRPEMYEAHDALLCIAQGRTMAE 228
gi 58038565   155 LLSRLEEAFRGNIAVELNRFG------EAGEQEVESVLIPMADQMDIPLVATNECFFPKPEMHEAHDALLCIAQGRTIAE 228
gi 114327944  156 LLAVLKEAFPDRTVIELHRHG------LRLEKAIEPGLIALADAAGLPLVATNDCYFAQPDMYEAHDALLCIAEGRVLSE 229
gi 83311668   126 VLARLARAFAGRCYVELMRHN------LEVEDRIEPLLVSLAYKHDLPLVATNEAFFADRGMYEAHDALVCIAEGAYISQ 199
gi 114569928  160 YLDQLASAFGDRLYVELQRHG------LEAELEAEDWLVGQAYARDLPLVATNEAYFPDQSMHKAHDALLCISESSFVSV 233
gi 119384499  151 LAERLAAAFPTRLYVELQRHHdaegqpVPEETGSEGGMIDIAYALDLPLVATNDVYFPKPELFDAHDALICISERAYVDQ 230
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110681190  238 QDdRRRLTNQHYFKSQSEMVALFADLPEAIENTVEIAKRCAFQAYRRDPILPKFAD-----DEVEELRKQAHAGLKARLE 312
gi 148261382  229 AE-RRRVTPHHWFKPAAEMRRRFADLPDACDNTLAIARRCAIAAPTRKPLLPICPKvrdgaTEAETLRAMAEEGLALRLA 307
gi 16126169   236 DE-RRRVTPEHWFKPAEEMRKLFADLPEACDNTLDIARRCAFMVHKRDPILPSFPTgdg-rnEAEELEHQAREGLKMRLE 313
gi 167646770  236 DE-RRRVTPEHWFKSSADMRKLFADLPEACDNTLDIARRCAFMVQKRDPILPSFPTgdg-rsEPEELTHQAKEGLRKRLD 313
gi 162148792  229 RD-RWRVTPEHWFKPPAMMRDLFADLPEACDNTLAIARRCAVRVETRKPLLPVCPKvqpgaTEEQTLRAMAEDGLARRLA 307
gi 58038565   229 ED-RWHVSPQAWFKTPAEMRAVFHDLPEACDNTLIIAQKCAVAACTRKPLLPICPKvregsTEEETLRAMAWEGLEKRLD 307
gi 114327944  230 TD-RRRVTPDHWFKPPEMMRALFSDLPEACDNTIAIARSCVVMAETRKPLLPVCPKvhegqTEDETVRAMAVEGLERRME 308
gi 83311668   200 DE-RRRLTPEHYFKSPEEMRALFADLPEACDNTLVIARRCAFGVAKRKPILPPYRMdg--lTEAEVLRKKTWEGLEARLE 276
gi 114569928  234 AD-RRRVTADHYLTTPEEMNARFADLPEALTNTIEIARRCAFRVRTHAPILPSFPTeg-grTEVEELIARAHEGLTDRLA 311
gi 119384499  231 TApRRRLTPQHYFKSAAEMATLFADLPEAIRNTVEIARRCAFAVKKHKPILPRFAD-----DEVEELRRQAWDGLRARLA 305
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110681190  313 VI--PHAASVEd-------YTKRLDFELGIIEGMGFPGYFLIVADFIKWAKEQGIPVGPGRGSGAGSLVAYALTVTDLDP 383
gi 148261382  308 AMnaDAATAAK--------YRERLALELGIIEQMGFPGYFLIVADFIQWAKSQGIPVGPGRGSGAGSLAAWALLITDIDP 379
gi 16126169   314 g--lTLSAPEEe-------YWKRLDFELGIIKKMGFPGYFLIVSDFIKWGKAHGIPVGPGRGSGAGSLVAWVLTITDLDP 384
gi 167646770  314 g--lELAVDEKv-------YWDRLDFELSIIIKMGFPGYFLIVSDFIKWAKEHGIPVGPGRGSGAGSLVAWVLTITDLDP 384
gi 162148792  308 RMdmDDATRQV--------YRDRLTFELDIIAKMGFPGYFMIVADFIQWAKAHDIPVGPGRGSGAGSLAAWALTITDIDP 379
gi 58038565   308 AInaGEEKRKL--------YSERLQVELDIIARMGFPGYFLIVADFIQWAKAHDIPVGPGRGSGAGSLVAYALTITDIDP 379
gi 114327944  309 DVgaGPEDRAR--------YRERLDYELDVIARMGFPGYFLIVADFIQWAKANDIPVGPGRGSGAGSVVAWALTITDLDP 380
gi 83311668   277 KHvfKEGMTDDekehaakpYRERIEFELNVIEEMGFPGYFLIVSDFIQWSKAQEIPVGPGRGSGAGSAVAWALTITDLDP 356
gi 114569928  312 SI--NAAAPEAd-------YRARLDFELDIIKQMGFPGYFLIVSDFIQWAKNNDIPVGPGRGSGAGSLVAYALTITDLDP 382
gi 119384499  306 VI--PHSATVEe-------YEERLRFELGIIEQMGFPGYFLIVADFIKWAKEHNIPVGPGRGSGAGSLVAYALTITDLDP 376
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110681190  384 LRYNLLFERFLNPERVSMPDFDIDFCMDRREEVIRYVQEKYGRDKVGQIITFGALLSKAAVRDIGRVLQMPYGQVDRLSK 463
gi 148261382  380 IPFNLLFERFLNPERVSMPDFDIDFCQERRDEVIAYVRREYGADRVAQIITFGKLQARAAVRDVGRVLGLPYGQVNKVAE 459
gi 16126169   385 LRFGLLFERFLNPERVSMPDFDVDFCQERREEVISYVQEKYGRDRVAQIITFGSLQARAVLRDVGRVMQLPLGLVDRLCK 464
gi 167646770  385 LRFGLLFERFLNPERVSMPDFDIDFCQERREEVIVYVQEKYGRDRVAQIITFGSLQARAVLRDVGRVMQLPLGLVDRLCK 464
gi 162148792  380 IPFNLLFERFLNPERVSMPDFDIDFCQDRRDEVIRYVRGEYGPDRVAQIITFGKLQARAAVRDVGRVLGLPFGMVNKVAE 459
gi 58038565   380 IPFGLLFERFLNPERVSMPDFDIDFCQDRRDEVIRYVREEYGGSRVAQIITFGKLQAKAAVRDVGRVLGLPYGMVNRVAE 459
gi 114327944  381 LRFNLLFERFLNPDRISMPDFDIDFCQDRRDEVISYVRGEYGGDRVAQIITFGKLQAKAAVRDVGRVLGMPFGQVNKVAE 460
gi 83311668   357 LRWGLLFERFLNPERVSMPDFDIDFCQDRREETIRYVQGKYGYSQVAQIITFGKLQARAVLRDVGRVLQMPYGQVDRICK 436
gi 114569928  383 LRFGLLFERFLNPERVSMPDFDVDFCQERRGEVIRYVQEQYGHDRVAQIITFGTLQARAVVRDTGRVLQLPLGLVDRLAK 462
gi 119384499  377 IRYSLLFERFLNPERVSMPDFDIDFCMDRREEVIQYVQEKYGRDKVGQIITFGALLSKAAVRDVGRVLQLPFGQVDRLSK 456
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110681190  464 MIPVEGVKPVSIEKALADEPRLREEAKNEEVVARLLNYGQQVEGLLRNASTHAAGVVIGDRPLDALVPLYQDPRSEMPAT 543
gi 148261382  460 IVPNNPAKPIPLAEAVDAEPRLREMRDSDESVKRLIEIAMQVEGLYRHASTHAAGVVIGDRPLDELVPLYKDPRSDMLIT 539
gi 16126169   465 MVPNNPAAPVTLAQAIDLEPRLKQAKKEDANVSACLDVALQLEGLFRNASTHAAGLVIGDRPLTQLTPLYKDPRSDLPAT 544
gi 167646770  465 MVPNNPAAPVTLAQAIEIEPRLKQARDEDGNVKACLDVALQLEGLFRNASTHAAGVVIGDRPLTQLTPLYKDPRSDLPAT 544
gi 162148792  460 LIPNNPAKPVTLKQAIDGEPRLQEMRDTDEAIRRLMEIALQLEGLYRHASTHAAGVVIGDRQLVELVPLYRDPKSDMLVT 539
gi 58038565   460 LIPNNPAKPVSLSDAIEGEPRLQEMRDSDESLKRLMEIALQLEGLYRHASTHAAGVVIGDRELVELVPLYRDPKSDMLVT 539
gi 114327944  461 LIPNNPAKPPTLQEAIDGEPRLQQMRESDEAVKRLLEIALQIEGLYRHASTHAAGVVIGDRPLVELVPLYRDPKSDFLVT 540
gi 83311668   437 LVPNNPANPMTLEQALESEPLLKEQKERDEAVSHLIDLAMKLEGLYRHASTHAAGVVIGDRPLDELVPLYRDPRSDMPVT 516
gi 114569928  463 MVPANPANPVTLAQALDIEPRLREMRRDDESVDTLLTVALKLEGLFRNASTHAAGVVIGDRKLSELVPLYRDPRSDIPAT 542
gi 119384499  457 MIPVEGVKPVSVTKALADEPRLREAAREEV-VNRLLDYAAKIEGLLRNASTHAAGVVIGDRPLHRLVPLYRDPASDMPAT 535
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110681190  544 QFNMKWVEQAGLVKFDFLGLKTLTVIQNAVEQIMAsgrplhiaadgtelyepaPGTEN-DINAIPLDDERSYKLYASAKT 622
gi 148261382  540 QYSMKHVEQAGLVKFDFLGLTTLTIISRALNFLDG------------------LGTPV-DIAKIPLDDAKTYEMLSRAEA 600
gi 16126169   545 QFNMKWVESAGLVKFDFLGLKTLTVLDRAVKHLKK------------------RGFEI-DLGKLPFDDAKTYELLASGQT 605
gi 167646770  545 QFNMKWVESAGLVKFDFLGLKTLTVLDRAVKHLKK------------------RGEII-DLSRLPFDDTKTYELLASGQT 605
gi 162148792  540 QYNMKFVEQAGLVKFDFLGLTTLTILQRACQFLKG------------------LDVTV-DLTTLPLDDAPTYEMLARGDT 600
gi 58038565   540 QYNMKYVEQAGLVKFDFLGLTTLTILKRGLDFLKE------------------QGITV-DLSRIPLDDAKTFEMLAKGDT 600
gi 114327944  541 QFSMKHVENAGLVKFDFLGLTTLTILQRAVKFLAG------------------LGVSV-DLAHVPLDDERTYQMLQRGDA 601
gi 83311668   517 QFNMKWVESAGLVKFDFLGLKTLTVMVTAVKHVKKt-----------------KGIDI-DLSAIPLDDAKSYELLSRGDA 578
gi 114569928  543 QFNMKWVEPAGLVKFDFLGLKTLTVIARALGYIAS------------------TGKDVpDIEGLDFDDQATFDLLQSGHA 604
gi 119384499  536 QFNMKWVEQAGLVKFDFLGLKTLTVIQNAVDLINDggrplhvaadgrqlyepaKGAEN-QINAIPLDDKPSYDLFASART 614
                         650       660       670       680       690       700       710       720
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110681190  623 VAVFQVESSGMMDALKRMKPTCIEDIVALVALYRPGPMENIPTYCEVKNGlRELQSIHPLIDDILEETQGIIVYQEQVMQ 702
gi 148261382  601 GGVFQFETQGFRDVLRQMRPDRFEDLIAAVALNRPGPMANIPAYCARKHG-ESWESPDPSIHEILSETYGIMVYQEQVMQ 679
gi 16126169   606 VGVFQLESQGMRDTLRKMRCGSIEEITALISLYRPGPMDNIDTFVDCKFGrKPVDTLHPSLEAVLKETYGVIVYQEQVMQ 685
gi 167646770  606 VGVFQLESQGMRDTLRKMRCGSIEEITALISLYRPGPMDNIDTFVDCKFDrKPVDYLHPSLEVVLKETYGVIVYQEQVMQ 685
gi 162148792  601 GGVFQFEGAGMRDVLKQMRPTRLEDLIAAVALYRPGPMANIPDYCRRKHG-EAWEPPHEEIRSILEETYGIMVYQEQVMQ 679
gi 58038565   601 AGVFQFEGAGMRDMLKQMAASRLEDLIAGVSLYRPGPMANIPDYCRRKHG-EPWEPPHEEIRDILEETYGIMVYQEQVMQ 679
gi 114327944  602 GGVFQFESQGMRDVLRQMRPDRFEDLIAAVALYRPGPMANIPAYCQRKHG-EAWEPPHEDIRDILGETYGIMVYQEQVMQ 680
gi 83311668   579 AGVFQLESSGMRDVLRKMGPNRLEDLIAVVALYRPGPMDQIPRYIACKHGkEEPDYMHPLLEPILKETFGIMVYQEQVMQ 658
gi 114569928  605 IGVFQLESSGMRDTLKKMKPDAIEDLIALISLYRPGPMKNIDVYVDRKFGrAEVDCLHADLEGVLSETYGVIIYQEQVMQ 684
gi 119384499  615 VAVFQVESSGMMDALRRMKPTCIEDIVALVALYRPGPMENIPTYCEVKNGlRPLESIHPSIDDILAETQGIIVYQEQVMQ 694
                         730       740       750       760       770       780       790       800
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110681190  703 IAQVMAGYSLGGADLLRRAMGKKIAEEMAKERPKFEKGAVANGVDKDKAREVFDLLEKFANYGFNKSHAAAYAVVSYQTA 782
gi 148261382  680 IAQKMAGYSLGAADLLRRAMGKKIRAEMEAQRKIFVEGAVARGTAEAKAVEVFDLMAKFADYGFNKSHAAAYALVSYQTA 759
gi 16126169   686 IAQILAGYSLGEADLLRRAMGKKKKEEMDLQKIRFVSGAKEKNVPEEQSGSIFELVAKFAGYGFNKSHAAAYAFISYQTA 765
gi 167646770  686 IAQILAGYSLGEADLLRRAMGKKKKEEMDLQKIRFVAGAKEKDVPEAQSGSIFELVAKFAGYGFNKSHAAAYALIAYQTA 765
gi 162148792  680 IAQKMAGYSLGGADLLRRAMGKKIRAEMDKQREIFTEGAVGRGIDPEKAAEVFDLMAKFADYGFNKSHAAAYALVSYQTA 759
gi 58038565   680 IAQKMAGYSLGGADLLRRAMGKKIAAEMEKQRAIFTEGATARGIPQEKAVEVFDLMARFADYGFNKSHAAAYALVSYQTA 759
gi 114327944  681 IAQKLAGYSLGAADSLRRAMGKKIRAEMETHRSIFAEGASKRGIPDAKSGEIFDLMVKFADYGFNKSHAAAYALVAYQTA 760
gi 83311668   659 IAQVLSGYSLGGADLLRRAMGKKDREEMDRQRAKFVEGATARAVDGGQASMIFDKVAKFAEYGFNKSHAAAYALIAYQTA 738
gi 114569928  685 IAQILSGYSLGEADLLRRAMGKKKKEEMDKQKVRFLEGAEAKGVSREKASYIFELVAEFAGYGFNKSHAAAYAAIAYRTG 764
gi 119384499  695 IAQVMAGYSLGGADLLRRAMGKKIAEEMAKERPKFVEGCKAQGIDTKKAGEVFDLLEKFANYGFNKSHAAAYAVVSYQTA 774
                         810       820       830       840       850       860       870       880
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110681190  783 WLKANHPVEFMAGVMNCDIHLTDKLAIYFEEVRKrLELPWVPPCVNRSDATFKVA-----DGALVYALGALKNVGVEAMK 857
gi 148261382  760 WLRANHPAAFIAASMSLSQANHEKLAALKQDAVR-IGIPVLPPDINASAADFTVErqadgTLAIRYALAAIKRVGAGAMQ 838
gi 16126169   766 WLKANTPVEFFAASMSLDLSNTDKLAVFHQDARR-FGITVRAPDVNRSGADFEVE-----NGEVLYALGAIRNVGLEAMK 839
gi 167646770  766 WLKANTPVEFLAASMSLDLSNTDKLAVFHQDARR-FDIVVRPPDVNRSGADFEVE-----NGEVLYALGAVRNVGLEAMK 839
gi 162148792  760 WMKANHPVPFLAACMSLAREKTDKLAALRQEAER-LGIPVLPPDINASGPDFTVErladgRLGIRYALAAVKKVGFAAME 838
gi 58038565   760 WMKANHPVAFLAGCMSLAREKTDKLAALCQEARR-MNIPVLPVDINKSLADFSIEtledgRQGIRYALSAIKRVGAAAMQ 838
gi 114327944  761 YMKANYPEPFLAACMSLAINNTDKLAALRQEATR-LGISVLPPDINCSAADFRVEqredgRLAIRYALAAIKRVGLSAME 839
gi 83311668   739 WLKANYPAEFMAATMTYEMSNTDKLNSFRQELDR-LGIKLLPPDINASQPTFSVEvlpdgGSAVRYALAALKNVGEAAMK 817
gi 114569928  765 YLKANYPVEFMAALMSLDAANTDKLSAFFQEVRR-MKLDVRPPDVNASQADFSVE-----EGTIRFALGAIRNVGFVAME 838
gi 119384499  775 WLKANHPVEFMAAVMNCDIHLTDKLAVYKREADR-MGIETVPPCVNRSEALFSVK-----DGKILYALGALKGVGVEAMN 848
                         890       900       910       920       930       940       950       960
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110681190  858 LITDGRradpgdegsPDK-PFATLFDLARRVDLKRVGKRPLEMLARSGAFDALDANRRRVFGALDALVNYSAAIHEQKAS 936
gi 148261382  839 DVVRAR---------ANR-PFADLADFAARVDPRALNKAQIEQLARAGAFDRIDPNRARVAAGAELLVRRAQAEAESRAS 908
gi 16126169   840 HLVAVR---------AEGgPFRDVFDFVERIDPRQVNKRAIENLARAGAFDSIHKNRAQIVASADVLIAHAQSCHADRQG 910
gi 167646770  840 HLVAIR---------EEGgPFRDIFDFVERVDPKLVNKRAIENLARAGAFDSLSKNRAQIFASADVLIAHGQSIAADRQG 910
gi 162148792  839 ALVASR---------GDR-PFADLSDLAARVDPRQLNKMQIENLAKAGAFDTVVPNRALVAAAAETVLRRANTKAQEAAS 908
gi 58038565   839 SVVACR---------GDR-PFQDLTDFAERCDPKSLNKIQLESLAKAGAFDSLLKERHIVFSSADILLRRAQARAQEQQM 908
gi 114327944  840 AVVAAR---------GEQ-AFTDLADFAARVDPRQLNRMQIENLARAGAFDSLVPNRAAVHGAADMILRRAQAASEEKNS 909
gi 83311668   818 SLVDER---------ERGgRFKDVGDFAARMDSKVLNRRQLENMVKAGVFDSLDKNRGRLFKNADTLCRYAASAAEDRDS 888
gi 114569928  839 HIVEER---------TANgPFRDLYDFAERVDPRQVNKRTFENLAKAGAFDSLDPDRARVMASAETLISMAQHAAEQRES 909
gi 119384499  849 LIVQAR---------AGR-PFADMHDFARRVDMRRVGKRPLEMLARAGAFDALEPNRARVLKSLDGLVAWSTAVQEAAAS 918
                         970       980       990      1000      1010      1020      1030      1040
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110681190  937 NQVSLFGEAg--DDLPEPRLHPVDDWQPAERLSEEFKAVGFYLSGHPLDDYMGQLKRkwgndrgVPFMTLDELTEKvTER 1014
gi 148261382  909 GQINLFGDA---AAPEPLPLPDVPDWPAFERLSFEAEAVGYHLTAHPLDAYDTVLRR-------LGVVPSNLIEAR-AKA 977
gi 16126169   911 GQGGLFGSD---PGAGRPRLSKTENWNQVDLLDEELSAVGFYLTGHPLEDMVGMLRR-------RRTVMLAEAMAQ-AEA 979
gi 167646770  911 GQHALFGGD---PAAGRPRLKKTEPWSQVDLLDEELAAVGFYLTGHPLDDMVGVLRR-------RRTHMLTEVIPR-AEA 979
gi 162148792  909 GQIGLFGGGgptPAPEPLRLPDVTDWPEFERLGMEAEAIGFHLTAHPLDSYGLLLRR-------LGAVRATALEAA-AQA 980
gi 58038565   909 GQAGLFGGAg--QEREILRLNEGRPWPDFERLSLEASAIGFHMSAHPLDAYRSVLRR-------LGVTPSNALENA-AKT 978
gi 114327944  910 GQIGLFAGA---GTPEPLRLPSCPDWPDMERLSFEAEAIGFHLTAHPLDVYTVTLQK-------LRVLPSNRIEEHaARH 979
gi 83311668   889 SQMSLLGg----SNAPTLKLESGPDWSPHEKLNQEFEAVGFYLSAHPLDAYAKSMKR-------LNVLKIAELPRH-LQS 956
gi 114569928  910 AQASLFGGGgeeAQLERPRLPEPDPWTATQRLDAELSAIGFYLSGHPLDDLTEHLAG-------RGVVFFAEAPAR-VAD 981
gi 119384499  919 SQSSLFGGg---EDLPPPRPVAAPVWMPAEKLAEEHAAVGFYLSGHPLDDYQPALRR-------KGVQTLAEVTQA-AAD 987
                        1050      1060      1070      1080      1090      1100      1110      1120
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110681190 1015 GA-MNARLAGIVAGRQER-KSARGNRFAFAQMSDPTGAYEVTLFSDTLEAARDYLEAGSKVVVTVEATMESDQ-LKLLGR 1091
gi 148261382  978 GI-GRVKLAGAVVGRKER-TTRTGSRMAWVMLSDQAGGFEVTLFSELLATARELLAEGAMLLVTADLRLDGES-LRVTAV 1054
gi 16126169   980 GA-EAFRMCGVVRRRQER-ASQSGEKFAFVSLSDPTGEYEVLYPPESLRKCRDVLEPGKAVAIKVRAKARDGE-VRFFGD 1056
gi 167646770  980 GM-EAFRMCGVVRRRQER-ASQSGERFAFVSLSDPSGEYEVLFPPEALRKCREVLEPGKAVAIKVRAKARDGE-VRFFGD 1056
gi 162148792  981 GL-TRVKIAGCVVDRKER-PTRTGSKMAWVRLSDSSGGCEVTLFSEVLSRTRDILTAGTAVLVTADLRLDGEA-LRITGS 1057
gi 58038565   979 GT-TRVKIAGCVVDRKER-PTRTGKKMAWVNLSDSGGGCEVTLFSETLTSCRDLLVAGQAILVTAELKVDGDA-LRITAQ 1055
gi 114327944  980 GD-QRVRLAGCVVNAKER-TTRTGSRMAWVRLSDAGGSYEITVFSEVLSRSRDALRIGACVLVTADIKAEGEDsIRITAQ 1057
gi 83311668   957 GGkGRVRLAGSLLSKQER-VSAKGSRYAFLQFSDASGMFEVTCFSEILATSRELLDAGGPLLIDVDAKLEEDQ-LRMTCQ 1034
gi 114569928  982 GA-TALRLAGMVRRRQERvSNKNGERFAWTTLSDPTGEFEVFVNSDLLVSSRDILDSGQAVMVNCRVDERDEQ-ISFFAD 1059
gi 119384499  988 GA-LVAQLAGTVAHRQEK-KSARGTRFAFVGLSDPTGLYEVTVFSDTLDAHRQHLEPGANVVLQVQVEPSGDQ-VKLLAR 1064
                        1130      1140      1150      1160      1170      1180      1190      1200
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110681190 1092 SVGPIDAATADvSSMGLKVFVD-APEAVAAVATVLEGAGravkgRAQGPVMLCLMGADLPGeVEVELGQDFIVNPQIKGA 1170
gi 148261382 1055 DVEPLDKAAAN-AGAGLRITVE-GREALGSIRALLEREG-----RGKGRVLLAPRIDTGAR-LDIALPGGFNVSPRLAQA 1126
gi 16126169  1057 DAEPIEKAVEN-VVAGLRVHLSpSAAEIDALKRRLEPAQa----QKGGEVTFVAAIG-GGReIELRLPGRYTLDAALRGA 1130
gi 167646770 1057 DAEPIEKAIEN-MVAGLRMHLSpSATEIDALRRRLEAAAs----PRGGEVSLIAALG-GGReIEMKLPGRYTLDAALRGA 1130
gi 162148792 1058 DVVALEQAAAD-AAAELRIWFD-REDAITPIHAILSEEK-----GGRGKVILLPSVA-ETRdVEVRLGGAYRVTPRMAQM 1129
gi 58038565  1056 NVMDLEVAAAA-ERSEIRVWLK-EDASLPDLASLLEEVQ-----GGLGRVKLLPSVE-ETQdVEISIPGHYRVTPRLAER 1127
gi 114327944 1058 DIMPLDDAAGG-TAGMMRVWLK-DNADIGQIRAVLSRPDt----KGKGHVVLIPRLN-EDQeMEIELPGGFNVTPRLGQA 1130
gi 83311668  1035 RIASLDQEAAK-AAAGIRVIIS-DDSAIRQLADLING-------EARGRNLVRIVARADNReVELGLKSNITLSPKFMGS 1105
gi 114569928 1060 KIEPLDTKI---SAERLRIRLD-LPDALTGVHARLERANkr-adASHDAVIDLLLPLRDGGeIEMRLPGRHSADAALQAA 1134
gi 119384499 1065 SVMPLDQAVADaGANRLAVEIA-GLDAVPGIAEALARIQaelnaPARARGPISLRLKDGADlVDIEIAEDAPLTTPARQA 1143
                        1210
                  ....*....|...
gi 110681190 1171 IKSLSGVLEVEEI 1183
gi 148261382 1127 MKMIRGVAEVAEL 1139
gi 16126169  1131 LKTAPGVALLEDV 1143
gi 167646770 1131 LKTAPGVALLEDV 1143
gi 162148792 1130 IKAVAGVARVEQG 1142
gi 58038565  1128 LRTLRGVEKALQV 1140
gi 114327944 1131 LKLIPGVERVEEV 1143
gi 83311668  1106 LRSIPGIAEVEEI 1118
gi 114569928 1135 LKGVKGVASVETA 1147
gi 119384499 1144 LRVVPGVLEVVEE 1156
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap