Conserved Protein Domain Family
PRK09052

?
PRK09052: PRK09052 
acetyl-CoA acetyltransferase; Provisional
Statistics
?
PSSM-Id: 181626
View PSSM: PRK09052
Aligned: 90 rows
Threshold Bit Score: 698.677
Threshold Setting Gi: 118498011
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
194365431   4 QIQDAYIVAATRTPVGKAPKGMFRNTRPDDMLAHVLRSVVAQAPGVDVNRIDDAIIGCAMPEAEQGMNVARIGVLLAGLP 83 
134301485   1 MSENVYIVAAKRSAVTKGKKGGFAKKRPDELLADVLRRTVAEA-NINPNDIEDIVVGCAMPEAEQGLNVARISSLLAGLP 79 
115314462   1 MSENVYIVAAKRSAVTKGKKGGFAKKRPDELLADVLRRTVAEA-NINPNDIEDIVVGCAMPEAEQGLNVARISSLLAGLP 79 
156501984   1 MSENVYIVAAKRSAVTKGKKGGFAKKRPDELLADVLRRTVAEA-NINPNDIEDIVVGCAMPEAEQGLNVARISSLLAGLP 79 
187931203   1 MSENVYIVAAKRSAVTKGKKGGFAKKRPDELLADVLRRTVAEA-NINPNDIEDIVVGCAMPEAEQGLNVARISSLLAGLP 79 
54294241    1 -MTDVYVVDVLRTPVGKAPRGVFKNTLPDDLLAHTIKCLIHRHQNIDWQEIADVVIGCAMPEAEQGMNVARIASLLADLP 79 
54297262    1 -MTDVYVVDVLRTPVGKAPRGVFKNTLPDDLLAHTIKCLIHRHQNIDWQEIADVVIGCAMPEAEQGMNVARIASLLADLP 79 
148358885   1 -MTDVYVVDVLRTPVGKAPRGVFKNTLPDDLLAHTIKCLIHRHQNIDWQEIADVVIGCAMPEAEQGMNVARIASLLADLP 79 
296106933   1 -MTDVYVVDVLRTPVGKAPRGVFKNTLPDDLLAHTIKCLIHRHQNIDWQEIADVVIGCAMPEAEQGMNVARIASLLADLP 79 
52841583    1 -MTDVYVVDVLRTPVGKAPRGVFKNTLPDDLLAHTIKCLIHRHQNIDWQEIADVVIGCAMPEAEQGMNVARIASLLADLP 79 
194365431  84 NTIAAQTVNRFCSSGLQAVAQAADAIRLGNADLMLAGGTESMSMVPMMGNKIAMAPSVFD-NDHVAIAYGMGITAEKVAE 162
134301485  80 NSVPAFTINRYCSSGLQSIAIAANEIAQGNIDVAIGAGVESMSMIPFGGNKMSFSKEIFAkDENVAIAYGMGITAEMVAK 159
115314462  80 NSVPAFTINRYCSSGLQSIAIAANEIAQGNIDVAIGAGVESMSMIPFGGNKMSFSKEIFAkDENVAIAYGMGITAEMVAK 159
156501984  80 NSVPAFTINRYCSSGLQSIAIAANEIAQGNIDVAIGAGVESMSMIPFGGNKMSFSKEIFAkDENVAIAYGMGITAEMVAK 159
187931203  80 NSVPAFTINRYCSSGLQSIAIAANEIAQGNIDVAIGAGVESMSMIPFGGNKMSFSKEIFAkDENVAIAYGMGITAEMVAK 159
54294241   80 QSVPAMTINRFCSSGIQSIVTAADTIRNQEAHLALGGGVESMSMVPMGGNKYTANPSIFN-DEHVAIAYGMGITAENVAK 158
54297262   80 QSVPAMTINRFCSSGIQSIVTAADTIRNQEAHLALGGGVESMSMVPMGGNKYTANPSIFN-DEHVAIAYGMGITAENVAK 158
148358885  80 QSVPAMTINRFCSSGIQSIVTAADTIRNQEAHLALGGGVESMSMVPMGGNKYTANPSIFN-DEHVAIAYGMGITAENVAK 158
296106933  80 QSVPAMTINRFCSSGIQSIVTAADTIRNQEAHLALGGGVESMSMVPMGGNKYTANPSIFN-DEHVAIAYGMGITAENVAK 158
52841583   80 QSVPAMTINRFCSSGIQSIVTAADTIRNQEAHLALGGGVESMSMVPMGGNKYTANPSIFN-DEHVAIAYGMGITAENVAK 158
194365431 163 EWKVSREDQDAFALASHQKAMAAIQNGDFKDEISPYEIISHQPDLADGKrILTRNKLADTDEGPRPDSSAEGLAKLRPVF 242
134301485 160 DWNVSRQDQDAFALESHQKAIHAIESGYFKDEILPIDVDHNKPDEATGE-IIIHKQTITEDEGARKDTSLEALAKLKPAF 238
115314462 160 DWNVSRQDQDAFALESHQKAIHAIESGYFKDEILPIDVDHNKPDEATGE-IINHKQTITEDEGARKDTSLEALAKLKPAF 238
156501984 160 DWNVSRQDQDAFALESHQKAIHAIESGYFKDEILPIDVDHNKPDEATGE-IINHKQTITEDEGARKDTSLEALAKLKPAF 238
187931203 160 DWNVSRQDQDAFALESHQKAIHAIESGYFKDEILPIDVDHNKPDEATGE-IINHKQTITEDEGARKDTSLEALAKLKPAF 238
54294241  159 RWEITREQQDEFAIESHKKAIAAQERLDFNAEISPIEISVRCPDLNTSK-VEIKKKLINKDEGPRADTSYEAISKLKPVF 237
54297262  159 RWEITREQQDEFAIESHKKAIAAQERLDFNAEISPIEISIRYPDLKTSK-VEIKKKLINKDEGPRADTSYEAISKLKPVF 237
148358885 159 RWEITREQQDEFAIESHKKAIAAQERLDFNAEISPIEISIRYPDLKTSK-VEIKKKLINKDEGPRADTSYEAISKLKPVF 237
296106933 159 RWEITREQQDEFAIESHKKAIAAQERLDFNAEISPIEISIRYPDLKTSK-VEIKKKLINKDEGPRADTSYEAISKLKPVF 237
52841583  159 RWEITREQQDEFAIESHKKAIAAQERLDFNAEISPIEISIRYPDLKTSK-VEIKKKLINKDEGPRADTSYEAISKLKPVF 237
194365431 243 RNgqfGGTVTAGNSSQMSDGAGAVLLASEQAIKDYGLTPLARFVSFSVAGVRPEVMGIGPIAAIPKALKQAGLTQDQLDW 322
134301485 239 AN---GGSVTAGNSSQVSDGAAAVILVSEKYLKEHNLKPLGKFLGFAVAGVDPRIMGIGPIKAIPKVLRQTGLNIDDIDW 315
115314462 239 AN---GGSVTAGNSSQVSDGAAAVILVSEKYLKEHNLKPLGKFLGFAVAGVDPRIMGIGPIKAIPKVLRQTGLNIDDIDW 315
156501984 239 AN---GGSVTAGNSSQVSDGAAAVILVSEKYLKEHNLKPLGKFLGFAVAGVDPRIMGIGPIKAIPKVLRQTGLNIDDIDW 315
187931203 239 AN---GGSVTAGNSSQVSDGAAAVILVSEKYLKEHNLKPLGKFLGFAVAGVDPRIMGIGPIKAIPKVLRQTGLNIDDIDW 315
54294241  238 SL---KGTVTAGNSSQMSDGAGIALLASEKALKQYDLKPLGRLMSYAVAGVPPEIMGIGPVKAIPMALKRAGITLDQLDW 314
54297262  238 AL---NGTVTAGNSSQTSDGAGVALLASEKALKQYDLKPLGRLMSYAVAGVPPEIMGIGPVKAIPMALKRAGITLDQLDW 314
148358885 238 AL---NGTVTAGNSSQTSDGAGVALLASEKALKQYDLKPLGRLMSYAVAGVPPEIMGIGPVKAIPMALKRAGITLDQLDW 314
296106933 238 AL---NGTVTAGNSSQTSDGAGVALLASEKALKQYDLKPLGRLMSYAVAGVPPEIMGIGPVKAIPMALKRAGITLDQLDW 314
52841583  238 AL---NGTVTAGNSSQTSDGAGVALLASEKALKQYDLKPLGRLMSYAVAGVPPEIMGIGPVKAIPMALKRAGITLDQLDW 314
194365431 323 IELNEAFAAQSLAVIRDCGLDPSKVNPLGGAIALGHPLGATGAIRTATLLHGLRRRQQKYGMVTMCIGTGMGAAGIFEAL 402
134301485 316 IELNEAFAAQSLAVINDLKLDKNKVNPCGGAIALGHPLGATGTILTVKALHGLQRTSKKYAMITMCIGTGMGAAGIIEAC 395
115314462 316 IELNEAFAAQSLAVINDLKLDKNKVNPCGGAIALGHPLGATGTILTVKALHGLQRTSKKYAMITMCIGTGMGAAGIIEAC 395
156501984 316 IELNEAFAAQSLAVINDLKLDKNKVNPCGGAIALGHPLGATGTILTVKALHGLQRTSKKYAMITMCIGTGMGAAGIIEAC 395
187931203 316 IELNEAFAAQSLAVINDLKLDKNKVNPCGGAIALGHPLGATGTILTVKALHGLQRTSKKYAMITMCIGTGMGAAGIIEAC 395
54294241  315 IELNEAFAAQALAVIKDLDLPGEKVNPLGGAIALGHPLGATGTIRTATLLHGLRRTKGRYGMVTMCIGTGMGAAAIFEAL 394
54297262  315 IELNEAFAAQALAVIKDLDLPREKVNPLGGAIALGHPLGATGTIRTATLLHGLRRIKGRYGMVTMCIGTGMGAAAIFEAL 394
148358885 315 IELNEAFAAQALAVIKDLDLPREKVNPLGGAIALGHPLGATGTIRTATLLHGLRRTKGRYGMVTMCIGTGMGAAAIFESL 394
296106933 315 IELNEAFAAQALAVIKDLDLPREKVNPLGGAIALGHPLGATGTIRTATLLHGLRRTKGRYGMVTMCIGTGMGAAAIFESL 394
52841583  315 IELNEAFAAQALAVIKDLDLPREKVNPLGGAIALGHPLGATGTIRTATLLHGLRRTKGRYGMVTMCIGTGMGAAAIFESL 394
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap