Conserved Protein Domain Family
PRK09051

?
PRK09051: PRK09051 
beta-ketothiolase; Provisional
Statistics
?
PSSM-Id: 181625
View PSSM: PRK09051
Aligned: 85 rows
Threshold Bit Score: 651.254
Threshold Setting Gi: 148555801
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
78066549    1 MQREVVVVSGVRTAIGDFGGSLKDIAPTALGAQVVREVLKRAQVSGDEVGHVVFGNVVHTEPRDMYLARVAAIDGGVAQH 80 
119898463   2 ASREVVVLSAVRSAVGGFGGSLKDMEPAELGGVVVKEAISRAGVDPKQVTFATVGNCIPTESRYPYVARVATIQGGMSME 81 
237653324   2 ANREVVVLSAVRSAVGGFGGSLKDMEPSDLGAVVIKEAIARAGVDPKAVSFASVGHCIPTDSRYAYVSRVATINAGMSMD 81 
171463613   1 MSRDVVVLSAVRSAIGAFNGSLSSFEPSELGGIVMKEAVARSGVDPALINYITVGNTIPTDSRYAYVARVASVQAGLPME 80 
145589110   1 MSRDVVVLSAVRSAIGTFNGSLSSFEPSELGGIVMKEAVARSGVDPALINYVTVGNTIPTDSRYAYVARVASIQAGLPME 80 
71908635    1 MSRDVVVLSAVRSAIGAFGGALADFESTELAGIVMKEAIARSGVDPQAINYVTVGTTMPTDSRYAYVSRVASIQAGLSMD 80 
114319849   2 SDREVVVLSAARSAIGTFGGTLAGFEPADLGGLIIKEAVARSGVDPNQINYTTVGNCIPTESRSPYVARVAAVQGGLPHN 81 
257093726   1 MSREVVVLSAVRSAIGTFGGSLANMEPHELAGMVMKESIARSGVDPQQVNYVAVGNVIPTDSRFAYVARVASIQAGLPMD 80 
56478388    2 ANREVVVLSAVRSAVGGFGGSLKDMEPAELGAVVVKEAIARSGVDAKQISFAAVGNCIPTESRYPYVARLATVQGGMSMD 81 
89901055    1 MIKDVVVLSAARSAIGAFGGSLATMEPSELAGIVMKEAIARSGVDPKQIGNAVVGNCIPTDSRYAYVSRVASIQAGLPMD 80 
78066549   81 APALTVNRLCGSGLQAIVSAAQGVLLGDADIAIAGGAENMSRAPYSIPAARFGQRMGDMRAVDMMVGALNDPFQTIHMGV 160
119898463  82 SVAFAVNRLCGSAQQAIVNSAQAILLGDADYAVGGGVEVMSRGAYLMPALRNGARMGDTKAIDAMVAVLTDPFGVGHMGI 161
237653324  82 SVAFQVSRLCGSAQQAIVSSAQAIMLGDADFAIGGGVEVMSRGTYLLPALRSGARMGDTKAIDSMVAVLTDPFGVGHMGI 161
171463613  81 SVAMALNRLCSSGLQAIVTTAQQIMLGDCDYGIGGGVEVMSRGMYGSPAMRSGARMGDTKMLDLMVSVLTDPFGVGHMGV 160
145589110  81 SVAMALNRLCSSGLQAIVTTAQQIMLGDCDYGIGGGVEVMSRGMYGSPAMRSGARMGDTKMLDLMVAVLTDPFGVGHMGV 160
71908635   81 SVAMQVSRLCASGLQGIVTTAQNLMLGDADYGIGGGVEVMSKAAYLLPALRNGARMGDTKAIDSMVAVLTDPFGVGHMGI 160
114319849  82 STAVTVNRLCGSGMQAIVSTAQSILLGDADFGVGAGTEVMSKGGYLTPSARFGARMGDAKMVDMMVATLTDPFGVGHMGI 161
257093726  81 SVAMAVNRLCASGLQGVVSAAQNIMLGDSDYGIGGGVEVMSRGSYMLPAMRSGARMGDAKAIDMMVATLSDPFGVGHMGV 160
56478388   82 SVAFAVNRLCGSAQQAIVNSAQAIMLGDADFAIGGGVEVMSRGAYLLPALRSGARMGDTKAIDAMVAVLTDPFGVGHMGV 161
89901055   81 SIAMQVSRLCSSGLQGIVTAAQNIMLGDFDYGIGGGVEVMSRGSYMMPALRAGARMGDTKAIDMMVAVLTDPFGVGHMGL 160
78066549  161 TAENVAAKYGISRDAQDALALESHRRASHAAKAGYFKDQILPVElIGSKKGTpVVFDHDEHVRHDASLEDFSKLRPVFVK 240
119898463 162 TAENLAAKWGISREEQDAFALESQRRAAEAIADGRFKGQIVPIT-FETRKGP-VVFDTDEHPRA-TTMEALAKMKPAFKK 238
237653324 162 TAENLCTKHGITREEQDAFALESQKRAAAAIAEGRFKGQIVPIT-FETRKGT-VVFDTDEHPRM-TTMEALGKMKPAFKK 238
171463613 161 TAENLVEKWKLTREEQDAFAVESHRRAAHAIKEGRFKSQIVPIT-IKTRKGE-VVFDTDDHCKPDTTMETLAKMKAVFKK 238
145589110 161 TAENLVEKWKLTREEQDALAVESHRRAANAIKEGRFKSQIVPIT-IKSRKGD-VVFDTDEHCKPETTMETLGKMKAVFKK 238
71908635  161 TAENLAAKHGFSREDQDAFAVESQRRAAAAIDAGYFKSQIVPIV-KQTRKGD-VVFDTDEHLKRGTTMESLAKMKPAFKK 238
114319849 162 TAENLAEKWNISREEQDQFAAESQRRAQAAIEGGYFKDQIVPVT-IKSRKGE-KVFDTDEHPRFGVTVEDLAKMRPAFKK 239
257093726 161 TAENLAKKWNISREEQDAFSVESQRRAGAAIAEGRFKSQIVPIV-MKTRKGD-VVFDTDEHVKAGTTIEALAKMKPAFIK 238
56478388  162 TAENLTTKWNISREEQDAFALESQNRAAAAIADGRFKSQIVPIT-FETRKGP-VVFDTDEHPRM-TTMEALGKMKPAFKK 238
89901055  161 TAENLATKWNISREDQDAFACESQRRAAVAIAEGRFKSQIVPIV-QQTRKGE-VVFDTDEHGKANTTLESLAKMKPAFKK 238
78066549  241 ENGTVTAGNASGINDAAAAVLLMERSVAEQRGAQPLARLVAYAHAGVDPAYMGIGPVPATQKVLARAGLTVADLDVIEAN 320
119898463 239 D-GSVTAGNASGINDAAAFLVLADAAKASAAGHKPMARLVSYAIAGVPNDLMGEGPIPSSKLALQRAGLTLDKIDLIESN 317
237653324 239 D-GSVTAGNASGINDAAAFLVLADAAKAAAGGHKPIARLVSYAIAGVPNDVMGEGPIPATKLALQRAGLKLDQIDVIESN 317
171463613 239 EGGSVTAGNASGINDGAAFFVLADAETAKKAGHKPIARLVSYAVAGVPNHIMGEGPIPATKLALERAGLKLDQIDVIESN 318
145589110 239 EGGSVTAGNASGINDGAAFFVLADAETAKKAGHKPIARLVSYAVAGVPNHIMGEGPIPATKIALERAGLKLEQIDVIESN 318
71908635  239 D-GTVTAGNASGINDGAAFFVLAAADVAAKAGHKARARIAGYAVAGVPNDVMGEGPIPATKAALKKAGLTLDQMDVIESN 317
114319849 240 EGGTVTAGNASGINDAAAALVLADRAAAEKAGHKPVARMVAYGIAGVPNDIMGEGPIPSSKVALDKAGLSIEDMDVVESN 319
257093726 239 D-GTVTAGNASGINDGAAFLMLAAADVAAQAGQKPIARLVAYAIAGVPNEIMGEGPIPASKLVLKKAGLTLDQMDVIEAN 317
56478388  239 D-GSVTAGNASGINDAASFLVLAEAGKAAAAGHKPIARLVAYAIAGVPNDLMGEGPIPASKLALQRAGLTLDKIDVIESN 317
89901055  239 D-GTVTAGNASGINDGAAFFVLAAADVAAKAGQKPIARIVSYAIAGVPNELMGEGPIPATKLALKKAGLTLDQMDVIEAN 317
78066549  321 EAFAAQACAVTQELGLDPAKVNPNGSGISLGHPIGATGALITVKALYELQRVGGRYALVTMCIGGGQGIAAIFERI 396
119898463 318 EAFAAQSLTVAKGLELDPAKTNPNGGAIALGHPVGATGAVIITKLLHELQRTGGRYGMATMCIGGGQGITTIWERI 393
237653324 318 EAFAAQSITVNRGLGLDTAKVNPNGGAISLGHPVGATGSVIITKLLHELIRTNGRYGVATMCIGGGQGITTVWERV 393
171463613 319 EAFAAQALAVTKGLGLDPAKTNVNGGAIALGHPIGCSGAAIATKAIHELHRVQGKYALVTMCIGGGQGIATIFERL 394
145589110 319 EAFAAQALAVTKGLGLDPAKTNVNGGAIALGHPIGCSGAAIATKAIHELHRVQGKYALVTMCIGGGQGIATIFERL 394
71908635  318 EAFAAQALSVSKVLGLDPAKTNPNGGAIALGHPVGCSGAFIATKALYELERIGGKYALVTMCIGGGQGIAVIFERA 393
114319849 320 EAFAAQALTVMKGLGLDPAKTNVNGGAIALGHPVGATGSILAVKAIHELHRIQGKYALVTMCIGGGQGITAIFERM 395
257093726 318 EAFAAQAIAVNKGLGLDPVKTNPNGGAIALGHPVGCSGAFIATKAIYELQRTGGKYALVTMCIGGGQGIAVIFERA 393
56478388  318 EAFAAQSIAVNRGLDLDPKKTNPNGGAIALGHPVGATGGVIITKLLHELIRVNGRYGMATMCIGGGQGITTIWERV 393
89901055  318 EAFAAQAIAVNKGLGLDPVKTNPNGGAIALGHPVGCSGAFIATKAVYELQRTSGKYALATMCIGGGQGIAVIFERI 393
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap