Conserved Protein Domain Family
PRK09050

?
PRK09050: PRK09050 
beta-ketoadipyl CoA thiolase; Validated
Statistics
?
PSSM-Id: 181624
View PSSM: PRK09050
Aligned: 141 rows
Threshold Bit Score: 684.761
Threshold Setting Gi: 21241140
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
300725370   1 MTYAFICDGIRTPIGRYGGALSGLRADDLAALPLRALMARYPALDREQIDDVILGCANQAGEDNRNVARMALLLAGLPDS 80 
78045936    1 MSEVYLIDGIRTPIGRYGGALSSVRADDLGAVPIAALLARQSQLEPASIDDVYLGCANQAGEDNRNVARMSLLLAGLPSS 80 
58580104    1 MSDVYLIDGIRTPIGRYGGALSSVRADDLGAVPIAALLVRHPQMEPAAIDDVYLGCANQAGEDNRNVARMSLLLAGVPSS 80 
84622104    1 MSDVYLIDGIRTPIGRYGGALSSVRADDLGAVPIAALLVRHPQMEPAAIDDVYLGCANQAGEDNRNVARMSLLLAGVPSS 80 
188578914   1 MSDVYLIDGIRTPIGRYGGALSSVRADDLGAVPIAALLVRHPQMEPAAIDDVYLGCANQAGEDNRNVARMSLLLAGVPSS 80 
21241140    1 MNEVYLIDGIRTPIGRYAGALSSVRADDLGAVPIAALLARQSQLEPAAIDDVCLGCANQAGEDNRNVARMSLLLAGLPPS 80 
21229844    1 MSEVYLVDGIRTPIGRYGGALSSVRADDLGAVPIAALLARHPQLDPAAIDDVYLGCANQAGEDNRNVARMSVLLAGLPSS 80 
66766721    1 MSEVYLVDGIRTPIGRYGGALSSVRADDLGAVPIAALLARHPQLDPAAIDDVYLGCANQAGEDNRNVARMSVLLAGLPSS 80 
188989788   1 MSEVYLVDGIRTPIGRYGGALSSVRADDLGAVPIAALLARHPQLDPAAIDDVYLGCANQAGEDNRNVARMSVLLAGLPSS 80 
115522276   1 MADVFVCDAVRTPIGRFGGALAKVRTDDLAAAPIKALLAKHPDLDWAAVDEVFYGCANQAGEDNRNVARMALLLAGLPDS 80 
300725370  81 VSGTTVNRLCGSGLDALAFAARSIKAGDAQLVLAGGVESMTRAPFVMGKADSAFSRQTEIFDTTLGWRFINPLMQQQFGI 160
78045936   81 VPGSTLNRLCGSGLDAIGTVARGIRAGELDLAIAGGVESMSRAPWVMGKADSAFARTQQLEDTTMGWRFINPRLQAVYGT 160
58580104   81 VPGSTLNRLCGSGLDAVGTVARGIRAGELDLAIAGGVESMSRAPWVMGKADSAFARNQQLEDTTMGWRFINPRLQAAYGT 160
84622104   81 VPGSTLNRLCGSGLDAVGTVARGIRAGELDLAIAGGVESMSRAPWVMGKADSAFARNQQLEDTTMGWRFINPRLQAAYGT 160
188578914  81 VPGSTLNRLCGSGLDAVGTVARGIRAGELDLAIAGGVESMSRAPWVMGKADSAFARNQQLEDTTMGWRFINPRLQAAYGT 160
21241140   81 VPGSTLNRLCGSGLDAIGTVARGIRAGELDLAIAGGVESMSRAPWVMGKADSAFARTQQLEDTTMGWRFINPRLQAVYGT 160
21229844   81 VPGSTVNRLCGSGLEAVGIAARGIRAGELELALAGGVESMSRAPWVMGKAESAFARNQHLHDTTMGWRFINPRLEATYGV 160
66766721   81 VPGSTVNRLCGSGLEAVGIAARGIRAGELELALAGGVESMSRAPWVMGKAESAFARNQHLHDTTMGWRFINPRLEATYGV 160
188989788  81 VPGSTVNRLCGSGLEAVGIAARGIRAGELELALAGGVESMSRAPWVMGKAESAFARNQHLHDTTMGWRFINPRLEATYGV 160
115522276  81 VPGQTLNRLCASGLDAVGAAGRAIRAGEIDLAIAGGVESMTRAPFVMGKAAEAFSRQADIFDTTIGWRFINPLMKAQYGV 160
300725370 161 DSMPETAENVAAQFQISRDDQDAFALRSQQRAANAQQRGILAEEIIPVTLPsgSKKGTDTTLSQDEHPRpTTTLEQLQRL 240
78045936  161 ELMGETAENVAQRYAIAREDQDAFALRSQQRVAAAQAAGFFDAEITPVAVAa-RKGGDASTVKHDEAPRpNTTADMLAKL 239
58580104  161 ELMGETAENLAQLHAIAREDQDAFALRSQQRVAAAQAAGFFDGEITSVAVAg-RKGGDASTVEYDEAPRpNTTAEMLAKL 239
84622104  161 ELMGETAENLAQLHAIAREDQDAFALRSQQRVAAAQAAGFFDGEITSVAVAg-RKGGDASTVEYDEAPRpNTTAEMLAKL 239
188578914 161 ELMGETAENLAQLHAIAREDQDAFALRSQQRVAAAQAAGFFDGEITSVAVAg-RKGGDASTVEYDEAPRpNTTAEMLAKL 239
21241140  161 ELMGETAENVAQRYAIAREDQDAFALRSQQRVAAAQAAGFFDAEIAPVAVAg-RKGGDASTVEHDEAPRpNTTAEMLAKL 239
21229844  161 ELMGETAENVAQRYAISRDDQDAFALRSQQRTAAAQAAGFFDDEITAVAVAg-RKGGERVQVMRDEHPRaDASAEALARL 239
66766721  161 ELMGETAENVAQRYAISRDDQDAFALRSQQRTAAAQAAGFFDDEITAVAVAg-RKGGERVQVMRDEHPRaDASAEALARL 239
188989788 161 ELMGETAENVAQRYAISRDDQDAFALRSQQRTAAAQAAGFFDDEITAVAVAg-RKGGERVQVMRDEHPRaDASAEALARL 239
115522276 161 DAMPETGENVAEEFQISRADQDAFAIRSQQRAGAAIVAGYFAEEIVAVAAP--GGKAGPIMVDKDEHPRpETTLEGLSKL 238
300725370 241 KTPFRTDGTVTAGNASGINDGAAALLIASETAALRQGLTPRARIIATATCGVEPRIMGIGPLPATRKVLALTGLSLNQME 320
78045936  240 KPVFRQPGTVTAGNASGLNDGAAALLLASAQAVQTHRLTPRARVLGFASAGVEPAYMGIGPVPATQRLLARLHLRIAQFD 319
58580104  240 KPVFRQPGTVTAGNASGLNDGAAALLLASAQAVQAHRLTPRARVLGFASAGVEPAYMGIGPVPATQRLLARLHLRIAQFD 319
84622104  240 KPVFRQPGTVTAGNASGLNDGAAALLLASAQAVQAHRLTPRARVLGFASAGVEPAYMGIGPVPATQRLLARLHLRIAQFD 319
188578914 240 KPVFRQPGTVTAGNASGLNDGAAALLLASAQAVQAHRLTPRARVLGFASAGVEPAYMGIGPVPATQRLLARLHLRIAQFD 319
21241140  240 KPVFRQPGTVTAGNASGLNDGAAALLLASAQAVQTHRLTPRARVLGFASAGVEPAYMGIGPVPAAQRLMARLHLRIAQFD 319
21229844  240 KPVFRQPGTVTAGNAAGLNDGAASLLLASARALHLHGLTPRARVLGFASAGVEPTYMGIGPIPATQRLLARLGLQIAQFD 319
66766721  240 KPVFRQPGTVTAGNAAGLNDGAASLLLASARALHLHGLTPRARVLGFASAGVEPTYMGIGPIPATQRLLARLGLQIAQFD 319
188989788 240 KPVFRQPGTVTAGNAAGLNDGAASLLLASARALHLHGLTPRARVLGFASAGVEPTYMGIGPIPATQRLLARLGLQIAQFD 319
115522276 239 KPIVRNPGTVTAGNASGVNDGAAAMILASETAVKKHGLTPRARILGLASAGVPPRIMGIGPVPATRKLMERLRLTISDFD 318
300725370 321 VIELNEAFAAQSLAVMRQLGLPDDAEHVNPNGGAIALGHPLGMSGARLALTATRELERRAGRYALCTMCIGVGQGIAMII 400
78045936  320 AIELNEAFAAQALACTRALGLADDAAHVNANGGAIALGHPLGMSGARLALTLLRQLEAGNGRLGLASMCIGVGQGVALAI 399
58580104  320 AIELNEAFAAQALACTRAFGLADDAAHVNANGGAIALGHPLGMSGARLALTLLRQLEASNGRLGLASMCIGVGQGVALAI 399
84622104  320 AIELNEAFAAQALACTRAFGLADDAAHVNANGGAIALGHPLGMSGARLALTLLRQLEASNGRLGLASMCIGVGQGVALAI 399
188578914 320 AIELNEAFAAQALACTRAFGLADDAAHVNANGGAIALGHPLGMSGARLALTLLRQLEASNGRLGLASMCIGVGQGVALAI 399
21241140  320 AIELNEAFAAQALACTRAFGLADDAAHVNANGGAIALGHPLGMSGARLALTLLRQLEAGNGRFGLASMCIGVGQGVALAI 399
21229844  320 AIEFNEAFAAQALACTRAFGLADDAAHVNANGGAIALGHPLGMSGARLALTLLRQLDACNGRRGLASMCIGVGQGVALAI 399
66766721  320 AIEFNEAFAAQALACTRAFGLADDAAHVNANGGAIALGHPLGMSGARLALTLLRQLDACNGRRGLASMCIGVGQGVALAI 399
188989788 320 AIEFNEAFAAQALACTRAFGLADDAGHVNANGGAIALGHPLGMSGARLALTLLRQLDACNGRRGLASMCIGVGQGVALAI 399
115522276 319 LIELNEAFASQGIACLRQLGITEDADFVNPHGGAIALGHPLGMSGARLALTAVHGMEKRGGKLALATMCVGVGQGVAMAI 398
300725370 401 ERI 403
78045936  400 ERL 402
58580104  400 ERL 402
84622104  400 ERL 402
188578914 400 ERL 402
21241140  400 ERL 402
21229844  400 ERV 402
66766721  400 ERV 402
188989788 400 ERV 402
115522276 399 EKV 401
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap