Conserved Protein Domain Family
fadI

?
PRK08963: fadI 
3-ketoacyl-CoA thiolase; Reviewed
Statistics
?
PSSM-Id: 181597
View PSSM: PRK08963
Aligned: 146 rows
Threshold Bit Score: 694.421
Threshold Setting Gi: 110835313
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
77165211    1 MNKSRHAVIVAGLRTPFAKRRTALKHFSPLGLGKLVCGELLERVDIDPRTVEQVVFGQVIPSLQAPNVAREIVLGLGMPA 80 
108760875   6 rNGPRRVAIVRGLRTPFVKAGSVFSGLTALDLGRLVVQELVQKTDLDPNVIDQVVFGQVIPTLTAPSIAREVVIAAGLPK 85 
292492127   1 MNNNRQAVIVAAVRTPFAKRQTAFKHFTPLDLGKLVCAELLERADIDPKGVDQVVFGQVIPSLQAPNVAREIVLGIGLPP 80 
300114045   1 MNKSRQAVIVAGLRTPFAKRRTALKHFSPLDLGKLVCGELLERVDIDPKTVEQVVFGQVIPSLQAPNVAREIVLGLGMPA 80 
304309698   8 RNSNGRVAIVDAVRTPFARIATAYRDLNAIDLGVLVVKELIERNQLNAEDVQQLVFGMTVMIPEAPFIAREIALQAGYP- 86 
110835313   9 AGRGGRVAIVDGLRTPFARIATHYRDLNAIDLGAMAVKELMARNNLSQNEIEQLVFGMTVMIPEAPFIAREIALALGMD- 87 
86156835    7 pppGRRAAVVAGLRTPFVKAGTDFKDLSATELGALLVNELVVRSGLPPNAFDSVVFGQVIPSPTVTLIGREMVLRTQLPR 86 
153007000   7 vppGRRAAVVAGLRTPFVKAGTDFKDLSAVELGALVVNELLARSGIPPKEFDSVVFGQVIPSPTVTLIGREMVLRTQLPR 86 
197120855   7 pppGRRAAVVAGLRTPFVKAGTDFKDLSATDLGALVVNELVVRSGLPPKAFDSVIFGQVIPSPTVTLIGREMVLRTQLPR 86 
220915555   7 pppGRRAAVVAGLRTPFVKAGTDFKDLSATDLGALVVNELVVRSGLPPEAFDSVIFGQVIPSPTVTLIGREMVLRTQLPR 86 
77165211   81 EIPAYTVSKACITSYQTTVNVLEAIQEGAIECGIAGGTESASDVPIAVSKPFQEALHEAASAKTLLQRLAAFKEISLRDL 160
108760875  86 KIDAFTVSRACATSIQALTTAANAIATGEADVIIAGGTESMSDAPIFTSRPLAHALVAASKGRSLPDKLKPFQRLKAKDL 165
292492127  81 GIPAYTVSKACITSYQTTVNVLEAIQEGAIECGIAGGTESASDIPITVSKPLQEALHEAASAKTMAQRLAAFRKLSLSDL 160
300114045  81 EIPAYTVSKACITSYQTTVNVLEAIQEGAIMCGIAGGTESASDVPIAVSKPLQEALHEAAGAKTLVQRLLAFKNLSPRDL 160
304309698  87 KMDAYSITRACATSFQTTASLADNILAGYTDIGIAGGTDSTSSVRIPLSSKLSSTLRDVNFAKTTQDKLKLLAQLKPKDV 166
110835313  88 TVDAYSITRACATSFQTTASVADNIVAGYTDMAIAGGTDSTSCARIPLSAKLSAVLRDVSFAKTLKDRIKLLSQLKARDL 167
86156835   87 SVQAHTVARACATSIQAATDVADQIRLGHSDCAIAGGAESVSDAPIFASRPLAQALVELSRARTLADRARILAGLRPRDF 166
153007000  87 SVQAHTVARACATSIQTTTDAADQILLGHSDCAISGGAESLSDAPIFATRTLAQALVEVSRAKTLADRLRILSALRPRDF 166
197120855  87 SVQAHTVARACATSIQAATDAADQIRLGHSDCAIAGGAESVSDAPIFASRPLAQALVELSRARTLADRARILAGLRPKDF 166
220915555  87 SVQAHTVARACATSIQAATDAADQIRLGHSDCAIAGGAESVSDAPIFASRPLAQALVELSRARTLAERARILAGLRPKDF 166
77165211  161 RPRPPAIAEPTTGETMGEAGERMAKENGISRQAQDEFARRSHQHAAQAWREGKFSEEVMAVPIPPeFTDTLEEDNLLRPE 240
108760875 166 LPVPPAIAEYSTGMTMGESAEKMAKENGISREEQDRIAFNSHRNAAKAWKDGLFDNEVMHVVVPPkFDKTAERDNIVRED 245
292492127 161 LPRPPAIAEPSTGETMGEAGERMAKENGISREAQDELARRSHQRAAQAWREGKFSDEVMAVHIPPdFTETLVEDNLLRPE 240
300114045 161 LPRPPAIAEPTTGETMGEAGERMAKENGISRQAQDEFARRSHQRAARAWREGRFSDEVMAVPIPPqFTATLEEDNLLRPE 240
304309698 167 LPQRPSITEYSVGETMGESCEKMVKKWGVTRAEQDDLAHASHSNAARAWAEGRMDKQVMEVHLPD--GKTFREDNLIRRN 244
110835313 168 LPQAPSITEYSVGETMGESTEKMVKKWGVSRQEQDDLAHASHSNAARAWAEGRLDRQVMTAHLPD--GSALKDDNLVRKQ 245
86156835  167 TPTPPALKEPTTGLTMGESAEKMAQVNGISRAAQDRLAYESHRRAAEAWDAGRFDEEVMHVPVPPrYDHVAARDNIVRKD 246
153007000 167 TPQPPALKEPTTGLTMGESAELMAQKNGISREAQDRVAYESHRRAAAAWESGKFDGEVMHVAVPPrFERVAARDNVVRKE 246
197120855 167 TPTPPALKEPTTGLTMGESAEKMAQVNGISRAAQDRLAYESHRRAAEAWDAGRFDAEVMHVPVPPrYDHVAARDNIVRKD 246
220915555 167 TPTPPALKEPTTGLTMGESAERMAQVNGISRAAQDRLAYESHRRAAEAWDAGRFDEEVMHVPVPPrYDHVAARDNIVRKD 246
77165211  241 SDLADYAKLNPVFDRK--YGSVTAGNSSPLTDGASALLLMNEAKARALGMPILGKIRSYAFAALDPFDQLLLGPAYATPI 318
108760875 246 SSMEALGQLKPAFDRK--YGTITAGNASPLTDGAAALLLMSEEKARALGYEPLGFLRSHAYAATDPGDQLLQGPAYAVPT 323
292492127 241 SDLATYTKLKPVFDRK--YGTVTAGNSSPLTDGASALLLMNEAKAKALGMPILGKVRSYAFAALDPFDQLLLGPAYATPI 318
300114045 241 SDLADYAKLKPVFDRK--YGSVTAGNSSPLTDGASALLLMNEAKAEALGMPILGRIRSYAFAALDPFDQLLLGPAYATPI 318
304309698 245 SERGSYDKLKPVYDTTsgKGSVTAGNSSPLTDGAGALLLMSEARAHALGYKPLGYIRSYAFAARTPRDDLLMGPVLAAPM 324
110835313 246 SERESYSKLNPVFDRE--TGSVTAGNSSPLTDGAGALLMMSEKKAAALGYTPLGYIRSYAFAARTPQDDLLMGPVLAAPA 323
86156835  247 TTVEALAKLRPVFDRR--YGTITAGNASPLTDGAAALVLMSEERAKALGIRPLGFVKAYAYAALDPRDQLLQGPAYAAPV 324
153007000 247 TTLEALAALKPVFDRR--YGTITAGNASPLTDGAAALVLMSEEKACALGLRPLGFVRSYAYAALDPLDQLLQGPAYAAPV 324
197120855 247 TTVETLAKLRPVFDRK--YGTITAGNASPLTDGAAALVLMSEERAKALGMKPLGFLKAYAYAALDPRDQLLQGPAYAAPV 324
220915555 247 TTVEALAKLRPVFDRK--YGTITAGNASPLTDGAAALVIMSEERAKALGMKPLGFLKAYAYAALDPRDQLLQGPAYAAPV 324
77165211  319 ALERAGMTLADMDVIDMHEAFAATTLSTIQAFESVSFAREKLNRSQPIGEVDWDKLNVNGGSIAMGHPFAATGAREIAQT 398
108760875 324 ALKRAGMTLADIDLVEMHEAFAAQVASNIQALASQAFAKKA-GWSAPVGEIDRERLNVTGGSIAIGHPFGATGARIVTQA 402
292492127 319 ALERAGMTLADMDLIDMHEAFAATVLSTLQAFESATFAREKLNRDKPIGEVNWDKLNVNGGSIAMGHPFAATGAREIAQT 398
300114045 319 ALERAGMTLADMDVIDMHEAFAATTLSTIQAFESATFAREKLNRSQPIGKVDWDKLNINGGSIAMGHPFAATGAREIAQT 398
304309698 325 ALERAGITLADLTLVDMHEAFAGQVACNLRGLNDAEYLKQNLGREMPTGEIDRSILNVNGGSVAYGHPFGATGARVIMQI 404
110835313 324 AMTRAGLTLSDLTLVDMHEAFAGQVACNLRGLADDDYVRSQTGLA-ALGEVDRSKLNVNGGSIAYGHPFGATGARVISQT 402
86156835  325 ALERAGLRLADMDLVDMHEAFAAQVLSNLQAFASKDFAERELGRSAPLGEVDPAKLNVNGGSIALGHPFAATGARMILQT 404
153007000 325 ALDRAGLRLADMDLVDMHEAFAAQVLSNLKAFASKDFAENELGRKEPLGEIDPAKLNVNGGSIALGHPFAATGARMILQT 404
197120855 325 ALERAGLRLADMDLVDMHEAFAAQVLSNLQAFASKDFAERELGRSEPLGEVDPARLNVNGGSIALGHPFAATGARMILQT 404
220915555 325 ALERAGLRLADMDLVDMHEAFAAQVLSNLQAFASKDFAERELGRSEPLGEVDPAKLNVNGGSIALGHPFAATGARMILQT 404
77165211  399 LGELKRRGGGVALCTACAAGGMGAAMVLEVT 429
108760875 403 INELKRRNKNTAMCTVCAAGGLGAVVILERA 433
292492127 399 LGELKRRGGGVALCTACAAGGMGAAMVLEVT 429
300114045 399 LGELKRRGGGIGLCTACAAGGMGAAMVLEVS 429
304309698 405 LYELQRRGGGLGLTTACAAGGIGAAMVLESA 435
110835313 403 LHELQHRGGGLALTTACAAGGIGAAMVLETE 433
86156835  405 LRELGRRGGQHALLTVCAAGGLGAAVVLERE 435
153007000 405 LRELERRQGQHALLTVCAAGALGAALVLERE 435
197120855 405 LRELGRRGGQHALITVCAAGGLGAAVVLERE 435
220915555 405 LRELGRRGGQHALITVCAAGGLGAAVVLERE 435
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap