Conserved Protein Domain Family
fadA

?
PRK08947: fadA 
3-ketoacyl-CoA thiolase; Reviewed
Statistics
?
PSSM-Id: 181592
View PSSM: PRK08947
Aligned: 176 rows
Threshold Bit Score: 724.063
Threshold Setting Gi: 92114510
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
192361509   5 PRDAVIVDYARSAMGRSKGGCFRNVRGDDISAAIIKGLLVRNPQLDPATIDDLLWGCVMQREEQAFNVARNILLLAGLPH 84 
294141902   1 MRDVVIIDAVRTPMGRSKKGVFRHTRADDLSAHLMKAILKRQPNLDAAQIDDVIWGCVQQTEEQGVNLARNASLLAGLPP 80 
299771813   6 PRDVVIVDGVRSAMGKTKNGMFRNVRADSLSAELVRALVARN-QFDTNEVEDLIWGCVNQTLEQGMNIGRNIGLLADLPK 84 
296112321   6 PKDVVIVDGVRTAMGKTKNGMFRHVRADDLSAKLIQALIARN-DIDPSELEDVIWGCVNQTLEQGWNIARYAALLAGVPK 84 
148653896   6 PKDVVIVDGVRTAMGKSKNGMFRNVRADSMSAELVRALVKRN-DFDTNEVEDIIWGCVNQTLEQGMNIGRNIGLLADIPK 84 
93007050    6 PKDVVIVDGVRSAMGKTKNGMFRHVRADSMSAELVRALVERN-DFDPRDVEDIIWGCVNQTLEQGLNIGRNIGLLAGIPK 84 
71066488    6 PKDVVIVDGVRSAMGKTKNGMFRHVRADSMSAELVRALVERN-DFDPRDVEDIIWGCVNQTLEQGLNIGRNIGLLAGIPK 84 
304310650   5 PRDVVIVDAIRTPMGKSKNGMFRNVRAEELSAHLIRTLQKRNANWKTDDTEDVIWGCVNQTLEQGMNIARIATLMSGLPR 84 
92114510    5 PRDIVVVDAVRTAMAKAKHGAFRNVRAENLSAAVMQALFDRNANLVPAEVDDVIWGCVNQTLEQSMNIARNAAIMTGIPR 84 
110834514   5 PKDVVIVDAVRTPMGKSRNGQFRHVRAEKLSAQLIQALMARNPNWDIQLTEDVIWGCVNQTKEQGMNIARNISMLAGLPR 84 
192361509  85 TVPAQTVNRLCGSSMSALHTATANIWAGLGDVYLIGGVEHMGHLPMYDAINPNPLLGLSVAKAAGNMGMTAEYLALLHGI 164
294141902  81 EVPATTVNRLCGSSMDALHMATRAIKAEDADIILVGGVEHMGHIPMTKGLNFNPSNDKVMAQASAMMGLTAEALSKLHNV 160
299771813  85 TVAGQTVNRLCGSSMQALHTAAAQIATNQGDIFIIGGVEHMGHVGMMHGIDLNPEASKHYAKASNMMGLTAEMLGRMNGI 164
296112321  85 TVAAQTVNRLCGSSMQALHTAAAQIMTNQGDMFIIGGVEHMGHVSMMHGVDPNPKASKHYAKASNMMGLTAEMLGRLNGI 164
148653896  85 TAGGQTVNRLCGSSMQALHTAAAQIMTNQGDVFIIGGVEHMGHVGMMHGIDINPEASKHYAKASNMMGLTAEMLGRMNGI 164
93007050   85 TAGGQTINRLCGSSMQALHTAAAQIMTGQGDVFIIGGVEHMGHVGMMHGVDLNPEASKHYAKASNMMGLTAEMLGRMNNI 164
71066488   85 TAGGQTVNRLCGSSMQALHTAAAQIMTGQGDVFIIGGVEHMGHVGMMHGIDLNPEASKHYAKASNMMGLTAEMLGRMNNI 164
304310650  85 TVGGQTVNRLCGSSMQALHTAATSIMTGNGDVFVIGGVEHMGHVGMMHGIDIAPQVSKYAAKASGMMGLTAEMLGRMHGI 164
92114510   85 TVPAQTVNRLCGSSMSALHIATANIKAGMGDFYIIGGVEHMEHVPMTHGVDVNPAASKYAAKAAMMMGLTAELLGKMHGV 164
110834514  85 TSAAQTVNRLCGSSMQALHSASQSIMTGNGDVFVIGGVEHMGHVAMDHGIDLNPEMSKVTAKASNMMGLTAEMLGKMHGI 164
192361509 165 TRQQMDEFGARSHQLAAKAREAGKFKREIIPVEGHDAEGFFTLVEHDETIRPDTTVEALAKLPPVFDPKNGQVTAGTSSQ 244
294141902 161 SREAQDALAERSHRLAHKATLEGKFDNEIVPTLGHDVSGRLILVKHDEVIRPETTMESLAKLRPAFDPIAGTVTAGTSSA 240
299771813 165 SREEQDAFGVESHRRAWAATQEGRFKNEIVGVEGHDANGFKILCDIDEVIRPDANLESFKALRPVFDPKGGTVTAATSSA 244
296112321 165 TREEQDTFGVHSHKKAWAATQAGRFDNEIVGVEGHDSEGNLQLCTVDEVIRPDANLEAFQALRPVFDPKNGTVTAGTASA 244
148653896 165 TREQQDEFGYESHRRAWAATQAGRFDNEIIGIEGHDAEGRLQLCTVDEVIRPDTSMESLAKLRPVFDPANGTVTAATSSA 244
93007050  165 TREEQDAFGLESHRRAWAATTEGRFDNEIIGIEGHDEAGRLQLCTVDEVIRPDATMEQMQKLRPAFDPVGGTVTAATSSA 244
71066488  165 TREEQDAFGLESHRRAWAATTEGRFDNEIIGIEGHDAAGRLQLCTVDEVIRPDATMEQMQKLRPAFDPVSGTVTAATSSA 244
304310650 165 SRQQQDEFALRSHKKAWEATLAGRWKNEIAPIEGHDENGFRVLCEIDEVIRQDATLEGLASLRPVFDPKSGTVTAGTSSA 244
92114510  165 GREEQDAFGVRSHQRAQAANENGYFDNEIVGVEGHDADGFLRLIDRDEVIRQDANLEDMGKLKPVFDPKGGTVTAGTSSA 244
110834514 165 TREQQDAFGVRSHKLAWEATQQGRWDNEIVPIEGHDQNGHKVLCEIDEVIRPGASIEDMQKLRPVFDPANGTVTAGTSSA 244
192361509 245 ISDGASVMLVMSAERAQSLGLKPIAKVVSMGLAGVDPSIMGYGPVPSTEKALKTANLSINDVEAVELNEAFAAQALPVLK 324
294141902 241 LSDGASCLLVMSAEKAKELGLTPRAKVISATTAGLPAAIMGFGPVPASQKALAKAGLTIDDIDFAEVNEAFAAQAIPCLK 320
299771813 245 LSDGASAMLLMSAERAQALGLKPRAVIRSMAVAGCDAAIMGYGPVPATQKALKRAGLTMADIQTIELNEAFAAQGLSVMK 324
296112321 245 LSDGASAMLIMSAQKAKDLGLKPRARIRGMAVAGCDAAIMGYGPVPATQKSLKRAGLNLSDIQTIELNEAFAAQGLSVLK 324
148653896 245 LSDGASAMLVMSAQKAKDLGLKPRARIRSMAIAGCDAAIMGYGPVPATQKALKRAGLTVEDMQTIELNEAFAAQGLSVLK 324
93007050  245 LSDGASAMLIMSAQKAKELGLKPRARIRSMAIAGCDAAIMGYGPVPATQKALKRAGMSIDDMQTIELNEAFAAQGLSVLK 324
71066488  245 LSDGASAMLIMSAQKAKELGLKPRARIRSMAVAGCDAAIMGYGPVPATQKALKRAGMSIEDMQTIELNEAFAAQGLSVLK 324
304310650 245 LSDGASAMLVMSAERAKAYGLKPRAKIRSMAVAGCDAAIMGYGPVPATQKALKRAGLSIEDIQIVELNEAFAAQSLPVLK 324
92114510  245 LSVGASALAVMSYERAQALGLEPLARVVSTGVAGCDASIMGYGPVPATQKALKSAGLAIDDIQTVELNEAFAAQSIPVLK 324
110834514 245 LSDGASAMLVMSAERAQALGLKPRAKIRSMAVAGCDAAIMGYGPVPATQKALARAGLTIDDIDYVELNEAFAAQSLPVAK 324
192361509 325 DLKLLDSMNDRVNLHGGAIALGHPFGCSGTRITGSLLTVMQDRDLTIGVSTMCIGLGQGITTVLERI 391
294141902 321 ELGLWDVVEEKVNLHGGAISLGHPLGCSGARIVGSLINIMEQRDGRYGLATMCIGMGQGIATIIERV 387
299771813 325 GLGIYDK-QDIINLNGGAIALGHPLGCSGARITTTLLNVMEQQDTQIGLATMCIGLGQGIATVIERV 390
296112321 325 GLDLLDK-QDIVNHNGGAIALGHPLGCSGARITTTLLNVMEQQDTQLGLATMCIGLGQGISTIIERI 390
148653896 325 ALNLLDK-RDIINVNGGAIALGHPLGCSGARITVTLLNAMEQMDTEIGLATMCIGLGQGISTVIERV 390
93007050  325 ALNLTDK-QDIVNINGGAIALGHPLGCSGARITVTLLNAMEQSDTEIGLATMCIGLGQGIATIIERV 390
71066488  325 ALNLTDK-QDIVNINGGAIALGHPLGCSGARITVTLLNAMEQSDTEIGLATMCIGLGQGISTIIERV 390
304310650 325 DLKLLDKVEEKVNLNGGAIALGHPLGCSGARITGTLLNIMEGKDATLGLATMCIGMGQGIATVIERV 391
92114510  325 DLGLRERMDDAVNLHGGAIALGHPLGCSGARICTTLLNVMRQQDTTLGLATMCIGMGQGVATVFERL 391
110834514 325 DLKLLDKMEEKVNLNGGAIALGHPLGCSGARITGTLLNVMEWKDGQIGLATMCIGLGQGIATIIERV 391
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap