Conserved Protein Domain Family
flgK

?
PRK08871: flgK 
flagellar hook-associated protein FlgK; Validated
Statistics
?
PSSM-Id: 181572
View PSSM: PRK08871
Aligned: 14 rows
Threshold Bit Score: 1096.43
Threshold Setting Gi: 54308103
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 262394933   1 MASDLLNVGTQSVLTAQRQLNTTGHNISNVNTEGYSRQSVIQGTNDPRMFGGSTYGMGVHVENVRRSWDQFAVNELNLSS 80
gi 227082315   1 MASDLLNVGTQSVLTAQRQLNTTGHNISNVNTEGYSRQSVIQGTNAPRQYGGETYGMGVHVENVRRSWDQFAVKELNIAS 80
gi 156973594   1 MASDLLNVGTQSVLTAQRQLNTTGHNISNANTEGYSRQSVIQGTNDPRQFGGSTYGMGVHVENVRRSWDEFAVKELNLST 80
gi 28897559    1 MASDLLNVGTQSVLTAQRQLNTTGHNISNVNTEGYSRQSVIQGTNDPRMFGGSTYGMGVHVENVRRSWDQFAVNELNLSS 80
gi 37679153    1 MASDLLNVGTQSVLTAQRQLNTTGHNISNVNTEGYSRQSVIQATNDPRQFGGSTYGMGVHVENVRRSWDQFAVNELNLST 80
gi 27363699    1 MASDLLNVGTQSVLTAQRQLNTTGHNISNVNTEGYSRQSVIQATNDPRQFGGSTYGMGVHVENVRRSWDQFAVNELNLST 80
gi 15642190    1 MASDLLNVGTQSVLTAQRQLNTTGHNISNVNTEGYSRQSVIQGTNAPRQYGGETYGMGVHVENVRRSWDQFAVKELNIAS 80
gi 218708810   1 MASDLLNVGAQSVLTAQRQLNTTGHNISNANTEGYSRQSVVQGVNDPRQYGGQTYGMGVHVENVRRSWDQFAVKELNLST 80
gi 209695756   1 MGLDLLNLGTQGVLTAQRQLNTTSHNINNVNTEGFSRQSVVQETNMPHWVSGANLGAGVHVAAVRRSFDQFATNELNLST 80
gi 59712475    1 MGLDLLNLGTQGVLTAQRQLNTTSHNINNVNTEGFSRQSVVQDTNMPHWVSGANLGAGVHVAAVRRSFDQFATNELNLST 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 262394933  81 TNNANKTDTQDNLDMLSSMLSSvASKKIPENLNEWFDAVKTMADTPNDLGARKVVLEKAKIFSDTLNDFHETVRLQSDVT 160
gi 227082315  81 TDYAFKRDTEENLDMLSKLLSSvASKKIPENLNEWFDSVKSLADSPNDLGARKVVLEKSKLISQNLNDFHETVRLQKDIT 160
gi 156973594  81 TNYANKLDNEKNLDLLSSMLSSvASKKIPENMNEWFDAVKTMADTPNDMGARKVVLEKAKLLSDTLNEFHETVRQQSDVT 160
gi 28897559   81 TSNANKTDTQDNLDMLSSMLSSvASKKIPENLNEWFDAVKTMADTPNDLGARKVVLEKAKIFSDTLNDFHETVRLQSDVT 160
gi 37679153   81 TNFANKGDVEANLEMLSSMLSSvASKKIPENLNEWFDALKTLADSPNDIGARKVLLEKARIISETVNGFHETIRQQYDVT 160
gi 27363699   81 TNFANKGDVEANLEMLSSMLSSvASKKIPENLNEWFDALKTLADSPNDIGARKVLLEKARIISETVNGFHETIRQQYDVT 160
gi 15642190   81 TDYAFKRDTEENLDMLSKLLSSvASKKIPENLNEWFDSVKSLADSPNDLGARKVVLEKSKLISQNLNDFHETVRLQKDIT 160
gi 218708810  81 TNAANKADTEANLDMLSSMLSSvVSKKIPENLNEWFDSVKTLADTPNDVGTRKVVIEKAGLLSKTLNEFHETVRQQSDSA 160
gi 209695756  81 TNLNYSMDTEANLDVLTNMMSSiGAKRIPENINDWFDAVKTLSDSPNEIGARKVVLEKSRLISQSLNDFYENVRQQNADV 160
gi 59712475   81 TNLNYSMDTEANLDVLTNMMSSiGAKRIPENINDWFDAVKTLADSPNEIGARKVVLEKSRLVSQSLNDFYENVRQQNADV 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 262394933 161 NKKLDMGIERVNQLALEIRDVHRLMMRTPGPHNDLMDQHEKLVTELSEYTKVTVTPRKNaEGFNVHIGNGHTLVSGTEAS 240
gi 227082315 161 NKGLALGVERINQLALEIRDLQRLMMRVPGPHNDLMDKHEKLVSELSQYTKVTVTQRKHgEGFNIHIGNGHTLVSGTEAS 240
gi 156973594 161 NKSLDMGIERVNQLAVEIRDVHRLMMRTPGPHNDLMDQHEKLIKELSEYTKVTVTPRKNsEGFNVHIGNGHTLVSGTEAS 240
gi 28897559  161 NKKLDMGIERINQLALEIRDIHRLMMRTPGPHNDLMDQHEKLITELSEYTKVTVTPRKNaEGFNVHIGNGHTLVSGTEAS 240
gi 37679153  161 NKKLDMGIERINQIAVEIRDIHRLMMRTPGPHNDLMDQHEKLVKELSEYTKVTVTPRKNaEGFNVHIGNGHTLVSGTEAS 240
gi 27363699  161 NKKLDMGIERINQIAVEIRDIHRLMMRTPGPHNDLMDQHEKLVKELSEYTKVTVTPRKNaEGFNVHIGNGHTLVSGTEAS 240
gi 15642190  161 NKGLALGVERINQLALEIRDLQRLMMRVPGPHNDLMDKHEKLVSELSQYTKVTVTQRKHgEGFNIHIGNGHTLVSGTEAS 240
gi 218708810 161 NKKLDMGIERVNQIAYEIRDLQRLMVRTPGPHNDLQDQHEQLVNELSGYTKVTVTPRANnEGFNVHIGNGHTLVSGTEAS 240
gi 209695756 161 NKKMDLTVERMNGIALELKDINKMMVKTPGPHNDLMDRHEKLIKELSQYTKVTITKRDNeNSFNVLIGGGHMLVSGTESS 240
gi 59712475  161 NKKMDLTVERMNAIALELKDINKMMVKTPGPHNDLMDRHEKLIKELSQYTKVTITKRDNeNSFNVLIGGGHMLVSGTNAS 240
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 262394933 241 QLKMIDGYPDVHQRRLAMVEGDGIKAIKSDDMDGKIGALLEMRDKHIPQLQDEMGRLATGFSYKINQLQSQGLDLNGKIG 320
gi 227082315 241 QLRVIDGFPDTQQHRLAMVEGKALKAISARDIGGKMEAILDMRDEHIPYLMDEVGRLALSFSHEVNTLQSQGLDLRGNVG 320
gi 156973594 241 QLKMIDGSPDVHQRRLAMVEGGGIKAIKSDDIDGKIGALLKMRDEHIPQVMDELGRLATAFSSEVNHLQSQGLDHYGNVG 320
gi 28897559  241 QLKMIDGYPDVHQRRLAMVEGDGIKAIKADDMDGKIGALLDMRDKHIPQLLDEMGRLATGFSYKVNQLQSQGLDLNGKIG 320
gi 37679153  241 QLKMIDGYPDVHQRRLAIYEGKSLKPIKSVGLDGKLGAMLDMRDKQIPYVMDELGRMAAGFSDEVNKLQKQGLDLRGNIG 320
gi 27363699  241 QLKMIDGYPDVHQRRLAIYEGKSLKPIKSVGLDGKLGAMLDMRDNQIPYVMDELGRMAAGFSDEVNKLQKQGLDLRGNIG 320
gi 15642190  241 QLRVIDGFPDTQQHRLAMVEGKALKAISARDIGGKMEAILDMRDEHIPYLMDEVGRLALSFSHEVNTLQSQGLDLRGNVG 320
gi 218708810 241 QLKMIDGVPDAHQRRLAIVEGKSLKAITNRDIDGQIGAMLDMRDEHIPAVMDELGRLATAFSYEVNALQSQGLDLNGNVG 320
gi 209695756 241 QLKMIQGTPDPLQRRLAMVEGNGVKAIQHDSIGGKLSSLFELRDKTIPTIMDELGRVAVGFSSEVNRLQSQAIDLRGQVG 320
gi 59712475  241 ELKMIAGSPDPLQRRLAMVEGKGMKAIQHDSIGGKLSALFELRDSTIPTIMDELGRVAVGFSSEVNRLQSQAIDLRGQIG 320
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 262394933 321 KDVFTDVNSELVAKSRVFAAPDSQADVAVYIDDISAIKGGEYSLRYDGDQYSVTTPKGEQMSLNIDQSDSSFVLDGMKVQ 400
gi 227082315 321 SALFTDVNLDVIARSRVVTNSNSKADMAVFIEDVSQLKGGEYSMQYNGSEFVVTLPSGQQTVLPVVKGN--VYVDGLRVE 398
gi 156973594 321 DPLFTDVNSERLAKSRVVAGPQSTADMAVYINDISALKGGEYSLRYDGDSYAVTKPNGETVKLNTDAGN-AFYIDGMRVE 399
gi 28897559  321 KDVFTDVNSELVAKSRVFTAPNSKADVAVYVDDISALKGGEYALRFDGDRYSVTTPKGEQVQIDIDQSDSTFVLDGMRVQ 400
gi 37679153  321 GVIFTDVNAEVIAKSRAVTAPDSQAEVAVFINDLASLKGGEYALRYDGSNYTVTKPSGETVSVSLDSAKSAFYMDGMRVE 400
gi 27363699  321 GVIFTDVNAEVIAKSRAVTAPDSQAEVAVFINDLASLKGGEYALRYDGSNYTVTKPSGETVSVSLDSAKSAFYMDGMRVE 400
gi 15642190  321 SALFTDVNLDVIARSRVVTNSNSKADMAVFIEDVSQLKGGEYSMQYNGSEFVVTLPSGQQTVLPVVKGN--VYVDGLRVE 398
gi 218708810 321 KNLFTDVNSELVAKSRVTAHGQSKADVAVYIDDTSALKGGEYGLKYDGSDYVVIKPDGETVKVSTNSTGNAFYLDGMRVE 400
gi 209695756 321 ANIFSDVNSEQAVRSRAIIPGDSSAEIGVFIDDISLLKAGDYALKYDGSQYTVTRPTGEVQRLDPTGNPSTFFLDGMRVE 400
gi 59712475  321 ANIFSDVNSEQAARSRAIVQGGSSAEVGVFIDDISLLKAGDYALKYDGSQYTVTRPTGEVQRLDPTGNPSTFFLDGMRVE 400
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 262394933 401 IGEGLAAGERVLLRPTRSGAAIIKMETNDAKAIAAQSYEASTTFAQGNAKFKIREAGDVKEFEVTVQPADEKhdkpwLKI 480
gi 227082315 399 VRNPPQVGERILVRPTRNGAAAIRLATEDATKIAAQSFEASTTFAQGKAKFKILQAGDVREFEVIVSPTGDQ-----FAV 473
gi 156973594 400 VRNEPKVGEHVLLRPTRSSAAQMKVETTDPKAIAAQSYEASTTFAQGNAKFEILDAGDLREFEVVVSPTGDQ-----FAV 474
gi 28897559  401 IGEGLAAGERVLLRPTRSGAAIIKMETNDAKSIAAQSYEASTTFAQGSAKFNIREAGDVKEFEVTVQPPDEKhdkawLKI 480
gi 37679153  401 VRNEPKAGEKILLRPTRNSAAQMQVATNDASMIAAQSYEASTSFAQGTAQFNILAAGDLREFEVIVSPQGDQ-----FAV 475
gi 27363699  401 VRNEPKAGEKILLRPTRNSAAQMQVATNDASMIAAQSYEASTSFAQGTAQFNILAAGDLREFEVIVSPQGDQ-----FAV 475
gi 15642190  399 VRNPPQVGERILVRPTRNGAAAIRLATEDATKIAAQSFEASTTFAQGKAKFKILQAGDVREFEVIVSPTGDQ-----FAV 473
gi 218708810 401 VRNPPELGEKLLLRPTRNFAAQIQMETKDPKDIAAQSYEASTTFAKGTAGFKILAAGQLREFEVIVSPKGEQ-----FAV 475
gi 209695756 401 IREPLSAGERILLRPTRLAAGDMKLEMNEAEKIAAQSYASSATFATGNAKFKVLQSGDLKEFQVVISPAANQ-----FAV 475
gi 59712475  401 IREPLSAGERVLLRPTRIAAGEIKLEMNEAEKIAAQSYASSATFATGNAKFKVLQSGALKEFQVVISPAANQ-----FAV 475
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 262394933 481 TDNKGNLLSDKYSYPLDKDnpmIEISvpkshplykngdATVFELSEGALMNDKFTANLVPSEGGNGNLRKMQKIQTDKMM 560
gi 227082315 474 TDTKGNILLQPQPYPPTGP---VTVL------------GTTFELTEGALPNDKFTANLVPSEGDNGNLRKMINIQTAKRM 538
gi 156973594 475 TDTKGNVLMAPQPYPPTGP---VSVSlpsnhpaynnggATVFELSAGALANDKFTANLVPSEGDNGNLRKMQNIQTDKKM 551
gi 28897559  481 TDNKGNLLSDKYSYPLDKDdplIEISvpkshplykngdATIFELTEGALLNDKFTANLVPSEGGNGNLRKMQQLQTNKMM 560
gi 37679153  476 IDTKGNVVRSPEPYPPKGP---VSVTlpsshpsykegkETVFELTAGAWANDKFTANLVPSEGDNGNLRKMQQIQLDKKM 552
gi 27363699  476 IDTKGNVVRSPEPYPPKGP---VSVTlpsshpsykegkETVFELTAGAWANDKFTANLVPSEGDNGNLRKMQQIQLDKKM 552
gi 15642190  474 TDTKGNILLQPQPYPPTGP---VTVL------------GTTFELTEGALPNDKFTANLVPSEGDNGNLRKMINIQTAKRM 538
gi 218708810 476 TDPKGNILMQPQPYPPQGP---VTIN------------GTTFELTSGAVANDKFTANLVPSEGDNGNLRKLQDLQTGKVL 540
gi 209695756 476 LDMKGKMLLEPQTYPPKGP---VTVG------------GTTFELSGGAAANDKFAANLVPSEGDNGNLLLMQGLQTRKVM 540
gi 59712475  476 LDMKGKMLLEPQTYPPKGP---VTVG------------GTTFELTGGAAANDKFAANLVPSEGDNGNLLLMQGLQTRKVM 540
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 262394933 561 DGKSSTLIDVYHNLNTEVGLKSSTANRLASVARLEHEAAQERVASISGVNLDEEAANMMKFQQAYMASSRVMQAANDTFN 640
gi 227082315 539 NDNESTIIDLYHNLNTDVGLKMATMTRLTDVARLEKEAAQSRIASISGVNLDEEAANMMKFQQAYMASSRIIQASNDTFN 618
gi 156973594 552 NGNESTIMSLYFNLNTDVGLKTSTASRLADVAQLESEAAQERVASISGVNLDEEAANMMKFQQAYMASSRVMQAANDTFN 631
gi 28897559  561 DGKSSTLIDVYHNLNTEVGLKSATANRLASVARLEHEAAQERVASIAGVNLDEEAANMMKFQQAYMASSRVMQAANDTFN 640
gi 37679153  553 DGNQSTIIDVYHNLNTNVGLRNSTATRLANIAQHENEAAQERIASISGVNLDEEAANMMRFQQAYMASSRIMQAANDTFN 632
gi 27363699  553 DGNQSTIIDVYHNLNTNVGLRNSTATRLANIAQHENEAAQERIASISGVNLDEEAANMMRFQQAYMASSRIMQAANDTFN 632
gi 15642190  539 NDNESTIIDLYHNLNTDVGLKMATMTRLTDVARLEKEAAQSRIASISGVNLDEEAANMMKFQQAYMASSRIIQASNDTFN 618
gi 218708810 541 DDGESTILDLYHNLNTNTGLKSSTANRLSDIARLEKESAQERIASVSGVNLDEEAANMMKFQQAYMASSRIMQAANDTFN 620
gi 209695756 541 DEGRSTVIDLYQNVNTEVGLKKATATRLTEVARVETEAAQSRVASVSGVNLDEEAANMMKFQQAYMASSRIMKAADETFN 620
gi 59712475  541 DEGRSTVIDLYENVNTEIGLKKATASRLSEVSRVENEAAQSRVASVSGVNLDEEAANMMKFQQAYMASSRIMKAADETFN 620

                 ....*.
gi 262394933 641 TILQLR 646
gi 227082315 619 TILALR 624
gi 156973594 632 TILQLR 637
gi 28897559  641 TILQLR 646
gi 37679153  633 TILQLR 638
gi 27363699  633 TILQLR 638
gi 15642190  619 TILALR 624
gi 218708810 621 TILALR 626
gi 209695756 621 TILQLS 626
gi 59712475  621 SILQLS 626
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap