Conserved Protein Domain Family
PRK08869

?
PRK08869: PRK08869 
flagellin; Reviewed
Statistics
?
PSSM-Id: 236344
View PSSM: PRK08869
Aligned: 113 rows
Threshold Bit Score: 343.065
Threshold Setting Gi: 238025293
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 295678110   1 MLGINTNINSLVSQQNLTGSGSALSQAITRLSSGKRINSAADDAAGLAISNIMQTQINGLNQGVSNSNDGTSMVQTASSG 80
gi 188576764   1 --------MSLNAQRNLNTNSSSLALSIQQLSSGKRITSFAVDAAGGAIAERFTTQIRGLDVASRNANDGISLSQTAEGA 72
gi 78047578    2 AQVINTNVMSLNAQRNLNTNSSSLALSIQQLSSGKRITSFAVDAAGGAIAERFTTQIRGLDVASRNANDGISLSQTAEGA 81
gi 21242719    2 AQVINTNVMSLNAQRNLNTSSASMSTSIQRLSSGLRINSAKDDAAGLAISERFTTQIRGLDVASRNANDGISLAQTAEGA 81
gi 161898984   2 AQVINTNVMSLNAQRNLNTNSSSLALSIQQLSSGKRITSFSVDAAGGAIAERFTTQIRGLDVASRNANDGISLSQTAEGA 81
gi 194365670   2 AQVINTNTMSLNAQRNLSTSGSSLATTIQRLSSGSRINSAKDDAAGLAISERFGTQIRGTDVAIRNANDGISLAQVAEGS 81
gi 194365671   2 AQVINTNTMSLNAQRNLSTSGSSLATTIQRLSSGSRINSAKDDAAGLAISERFGTQIRGTDVAIRNANDGISLAQVAEGS 81
gi 194365672   2 AQVINTNTMSLNAQRNLSTSGSSLATTIQRLSSGLRINSAKDDAAGLAISERFTTQIRGLDVAIRNANDGISLAQVAEGS 81
gi 190574253   2 AQVINTNTMSLNAQRNLSTSGSSLATTIQRLSSGSRINSAKDDAAGLAISERFGTQIRGTDVAIRNANDGISLAQVAEGS 81
gi 190574254   2 AQVINTNTMSLNAQRNLSTSGSSLATTIQRLSSGSRINSAKDDAAGLAISERFGTQIRGTDVAIRNANDGISLAQVAEGS 81
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 295678110  81 LASLTSSLQRIRQLATQAANGSMTSDDRAALQKEVSQQISEVNRISSQTTYNGMNLLNGSLGTVTFQVGANVGQSISLNl 160
gi 188576764  73 MQEIGNNLQRIRELSVQSANATNSSTDREALNSEVKQLTSEIDRVANQTSFNGTKLLDGSFSGALFQVGADAGQTIGIN- 151
gi 78047578   82 MEEIGNNLQRIRELSVQSAKATNSSTDREALNSEVKQLTAEIDRVANQTSFNGTKLLDGSFSGALFQVGADAGQTIGIN- 160
gi 21242719   82 MVEIGNNLQRIRELSVQSSNATNSATDREALNSEVKQLTSEIDRVANQTNFNGTKLLDGSFSGALFQVGADAGQTIGIN- 160
gi 161898984  82 MQEIGNNLQRIRELSVQSANATNSSTDREALNSEVKQLTSEIDRVANQTSFNGTKLLDGSFSGALFQVGADAGQTIGIN- 160
gi 194365670  82 LTEIGNNLQRVRELSVQASNATNSASDRKALQAEVTQLVSEIDRVAKQSDFNGTKLLDGSFSSQLFQVGANAGQSIAID- 160
gi 194365671  82 LTEIGNNLQRVRELSVQASNATNSASDRKALQAEVTQLVSEIDRVAKQSDFNGTKLLDGSFSSQLFQVGANAGQAIAID- 160
gi 194365672  82 LSEVGNNLQRIRELAVQSSNATNSSSDRKALQAEVTQLVSEVDRVAKQADFNGTKLLDGSFTSQLFQVGANAGQAIAIN- 160
gi 190574253  82 LTEIGNNLQRVRELSVQASNATNSASDRKALQAEVTQLVSEIDRVAKQSDFNGTKLLDGSFSSQLFQVGANAGQAIAID- 160
gi 190574254  82 LTEIGNNLQRVRELSVQASNATNSASDRKALQAEVTQLVSEIDRVAKQSDFNGTKLLDGSFSSQLFQVGANAGQAIAID- 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 295678110 161 TQDMSAAKLGTGnvqvgntlgsfgdLSLNNSGQ-------TVATGATITSINVLADGKGGYTltdqnnQALsatTATAVl 233
gi 188576764 152 SIADANIDTLGR-------------ANFAAAVSaag-vsgTATASGSVSGISLSFKDASGSA------KSI---TIADVk 208
gi 78047578  161 SIADANIDSLGK-------------ANFAAAVSgag-vsgTATASGSVSGISLSFKDASGSA------KSI---TIADVk 217
gi 21242719  161 SIVDANVDSLGK-------------ANFAAAVSgag-vtgTATASGSITGISLAFNDASGTA------KTV---TIGDVk 217
gi 161898984 161 SIADANIDTLGK-------------ANFAAAVSaag-vsgTATASGSVSGISLSFKDASGSA------KSI---TIADVk 217
gi 194365670 161 KTIDAKAGSLGT-------------STFAAGATd------VLAASTDGSRITGKVMGVDIGT------VEL---KAGAT- 211
gi 194365671 161 KTIDAKANALGG-------------AKFDTNAL-------ALADPAANGDFKTTGMSINGVAiagidvKQGadaTATGK- 219
gi 194365672 161 SVVNAKADSLGA-------------ASFANGYTgtalatdKATADTTYSGLQISVTPPGGTA------TTI---TVNDFt 218
gi 190574253 161 KTIDAKANALGG-------------AMFDSVSFtia-apaDATTGVKMTGMTITNGAGSAISiadidvAAQggaDGTKT- 225
gi 190574254 161 KTIDAKANALGGaqfvtgtiaaptlTGTPATTAdi----aTFTLTSAQGTVTFDALKVENTD------------------ 218
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 295678110 234 sgvtitadANGNATITAANATGAGAAIATAL------------KTD-------MTTTVGGSTatlttsfTAASNTATGAT 294
gi 188576764 209 vga--gdtAADVNKKVASAINDKLDQTGMYA------------SIKsdg-svqIESLKAGQDft----sLSAGTSSAAGI 269
gi 78047578  218 vaa--gdtAADVNKKVASAINDKLDQTGMYA------------SIKsdg-svqIESLKAGQDft----sLSAGTSSAAGI 278
gi 21242719  218 ian--gddAATINKKVASAINDKLDQTGMYA------------SIDtsg-nlkLESLKAGQDft----sLTMGTSSATGV 278
gi 161898984 218 vga--gdtAADVNKKVASAINDKLDQTGMYA------------SIKsdg-svqIESLKAGQDft----sLSAGTSSAAGI 278
gi 194365670 212 --------TADASKAVATAINAKIGEAGIYAeanadgsmklssVKEg-----kAVVAADIAL-------ERSDLTAATGV 271
gi 194365671 220 ----------ASREALVTAINAKIGETGVYAevngtagvtltsVKDsvnadgsFKAITATPG------------TWTGGA 277
gi 194365672 219 v-----kaGESITSATSAAINNKLGETGVMA------------SVNagv--isLASVKDGQTftlgvsaATPPTGATAAT 279
gi 190574253 226 --------QDAATKAMVAAINAKIGETGVLA------------EVDaagggkiNLSSVKDS------------VDKNGAF 273
gi 190574254 219 --------AAGAGKALATHINAKIGETGILA------------EADat---gaLTLTSVKDS-------VKADGTLVQLT 268
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 295678110 295 I-DAL-----NVP----------------TNVASIDVSSQTGASAAMESIDNALTTLNNLQATLGAAQNRFSAIGSTQQA 352
gi 188576764 270 T-VGA-----GITtasaa------sgstaSTLGSLDISTFSGAQQALEIVDKALTTVNSSRADMGAVQNRFTSTIANLSA 337
gi 78047578  279 T-VGA-----GITtasaa------sgstaSTLGSLDISTFSGAQKALEIVDKALTTVNSSRADMGAVQKRFTSTIANLSA 346
gi 21242719  279 T-VGA-----GLQtasaa------sgstaVTLTDLDISTFAGSQQALEIVDKALTAVNSSRADMGAVQNRFTSTIANLSA 346
gi 161898984 279 T-VGA-----GITtasaa------sgstaSTLGSLDISTFSGAQQALEIVDKALTTVNSSRADMGAVQNRFTSTIANLSA 346
gi 194365670 272 WsAKAaagayTAGtd------------taANVQKLDVSTVLGAQQALEVVDKALGAINSTRADLGAIQNRFTSVVANLQT 339
gi 194365671 278 AaPTF-----TAStaa----------paaKYASDLDVSTVKGAQQAMEIVDKALGAINSTRADLGAIQNRFTSVVANLQT 342
gi 194365672 280 I-AGL-----GLTetstngg--tltgtsaSFVKDLNVTTAEGAQKALSIVDKALESVNSVRADLGAIQNRFTSVVANLQT 351
gi 190574253 274 LgIAVetgtwTGIatgpgditasttavakSFADKIDVSTVKGAQQAMEVVDKALGAINSTRADLGAIQNRFTSVVANLQT 353
gi 190574254 269 StGGV-----TVAgntt--------vparQYADKIDVSTVKGAQQAMEVVDKALGAINSTRADLGAVQNRFTSVVANLQT 335
                        410       420       430       440       450
                 ....*....|....*....|....*....|....*....|....*....|...
gi 295678110 353 QSTDLSSAQSSIQDANFAAETANLSKAQVLQQAGISVLAQANSQPQQILKLLQ 405
gi 188576764 338 TSENLSASRSRIADTDYAKSTAELTRTQILQQAGTAMLAQAKSVPQNVLSLLQ 390
gi 78047578  347 TSENLSASRSRIADTDYAKATAELTRTQILQQAGTAMLAQAKSVPQNVLSLLQ 399
gi 21242719  347 TSENLSASRSRIRDTDYAKETAELTRTQILQQAGTAMLAQAKSVPQNVLSLLQ 399
gi 161898984 347 TSENLSASRSRIADTDYAKSTAELTRTQILQQAGTAMLAQAKSVPQNVLSLLQ 399
gi 194365670 340 SSENLSASRSRIKDTDFAKETAELTRTQILQQAGTAMLAQANQVPQGVLSLLR 392
gi 194365671 343 SSENLSASRSRIKDTDFAKETAELTRTQILQQAGTAMLAQANQVPQGVLSLLR 395
gi 194365672 352 SSENLSASRSRIRDTDFAKETAELTRTQILQQAGTAMLAQANQVPQNVLSLLQ 404
gi 190574253 354 SSENLSASRSRIKDTDFAKETAELTRTQILQQAGTAMLAQANQVPQGVLSLLR 406
gi 190574254 336 SSENLSASRSRIKDTDFAKETAELTRTQILQQAGTAMLAQANQVPQGVLSLLR 388
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap