Conserved Protein Domain Family
PRK08835

?
PRK08835: PRK08835 (this model, PSSM-Id:103585 is obsolete)
DNA polymerase I; Provisional
Statistics
?
PSSM-Id: 103585
View PSSM: PRK08835
Aligned: 8 rows
Threshold Bit Score: -1
Threshold Setting Gi: 0
Created: 22-Jul-2008
Updated: 31-Jul-2008
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15640140    1 MAHIPDNPLILIDGSSYLYRAFHAYPGTMSNGEIPTNAIYGVVNMIRSMMRQFASDRMAVIFDAKGKTFRDEMYDQYKAH 80
gi 59710681    1 MARIPDNPFILVDGSSYLFRAYHAAPNFTNGDGQPTGAVYGVINMLRSLLKQFETDRIAVIFDAKGKTFRNDMYPEYKAN 80
gi 54310556   16 MATIPENPLILIDGSSYLYRAYHAAPNFTNSDGEPTGAVYGVVNMLRSLLRQFSTEHIAVIFDAKGKTFRDDIYPEYKAN 95
gi 147675220   1 MAHIPDNPLILIDGSSYLYRAFHAYPGTMSNGEIPTNAIYGVVNMIRSMMRQFASDRMAVIFDAKGKTFRDEMYDQYKAH 80
gi 156972895   1 MASIPENPLILIDGSSYLYRAFHAYPGTMSNGEIPTNAVYGVVNMLRSMMRQFASDRIAVVFDAKGKTFRDDMYPEYKAN 80
gi 28896881    1 MASIPENPLILIDGSSYLYRAFHAYPGTMSNGEIPTNAVYGVVNMLRSMMRQFASERIAVVFDAKGKTFRDEMYSEYKAN 80
gi 27364348    1 MATIPENPLILIDGSSYLYRAFHAYPGTMSNGDIPTNAVYGVVNMLRSMMRQFASDRIAVVFDAKGKTFRDDMYPEYKAN 80
gi 37678370   27 MATIPENPLILIDGSSYLYRAFHAYPGTMSNGDIPTNAVYGVVNMLRSMMRQFASDRIAVVFDAKGKTFRDDMYPEYKAN 106
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15640140   81 RPPMPDELRCQVEPLHQVIRAMGLPLLAIEGVEADDVIGTLARQASQAGMPVLISTGDKDMAQLVDDNITLINTMTNVVL 160
gi 59710681   81 RPPMPDDLRCQIEPLHKLIKAMGLPLVSIPGVEADDVIGTLASQASKAGIPVLISTGDKDMAQLVDENVTLINTMTNVIM 160
gi 54310556   96 RPPMPDDLRGQIEPLHAVIKAMGLPLIAISGVEADDVIGTLATQASKAGMPVLISTGDKDMAQLVDENVTLINTMTDVVM 175
gi 147675220  81 RPPMPDELRCQVEPLHQVIRAMGLPLLAIEGVEADDVIGTLARQASQAGMPVLISTGDKDMAQLVDDNITLINTMTNVVL 160
gi 156972895  81 RPPMPDDLRCQIEPLHNVIRAMGLPLICIPGVEADDVIGTLAYQASQQGMPVLISTGDKDMAQLVDDNVTLINTMTNVVM 160
gi 28896881   81 RPPMPDDLRCQIEPLHNVIRAMGLPLICVPGVEADDVIGTLAYQASQQGMPVLISTGDKDMAQLVDDNITLINTMTNVVM 160
gi 27364348   81 RPPMPDDLRCQIEPLHQVIKAMGLPLIAIEGVEADDVIGTLAYQASQQGMPVLISTGDKDMAQLVDDNITLINTMTNVVM 160
gi 37678370  107 RPPMPDELRCQIEPLHQVIKAMGLPLIAIEGVEADDVIGTLAYQASQQGMPVLISTGDKDMAQLVDDNITLINTMTNVVM 186
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15640140  161 DREGVIEKFGIPPELIIDYLALMGDKVDNIPGVPGVGEKTATALLQGIGGLEALYANLDKIAALGFRGSKTMAQKLEENR 240
gi 59710681  161 DPEGVVEKFGIGPELIIDYLALMGDKVDNIPGVPGVGDKTAKALLQGIGGLDALYEHLDDIAPLGFRGSKTMAKKLIDNK 240
gi 54310556  176 GPAGVVEKFGIGPELIIDYLALMGDKVDNIPGVPGVGEKTAKALLTGVGGLDAIYDNLDAIPALGFRGSKTMPKKLADNK 255
gi 147675220 161 DREGVIEKFGIPPELIIDYLALMGDKVDNIPGVPGVGEKTATALLQGIGGLEALYANLDKIAALGFRGSKTMAQKLEENR 240
gi 156972895 161 DREGVVEKFGIPPELIIDYLALMGDKVDNIPGVPGVGDKTATALLQGIGGLTKLYENLDDIAALGFRGSKTMAKKLVDNK 240
gi 28896881  161 DREGVVEKFGIPPELIIDYLALMGDKVDNIPGVPGVGDKTATALLQGIGGLTKLYENLDDIAALGFRGSKTMAKKLVDNK 240
gi 27364348  161 DREGVIEKFGIPPELIIDYLALMGDKVDNIPGVPGVGDKTATALLQGIGGLSQLYDHLDDIAALSFRGSKTMAKKLVDNK 240
gi 37678370  187 DREGVIEKFGIPPELIIDYLALMGDKVDNIPGVPGVGDKTATALLQGIGGLSQLYDHLDDIAALSFRGSKTMAKKLVDNK 266
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15640140  241 GNAKLSYQLATIKCDVELEESPQTLLKQTPDRDALMSLYGKLAFKSWLTELLDGGTGIVTADEQTKTSsvtVSTAATHAA 320
gi 59710681  241 EGAYLSYELATIKLDVELDKTPEEFVKQEPNVDELIQMFGQMNFKRWLTEMLDGSDGKIVSHETSSNSv--STSSKQDDA 318
gi 54310556  256 EAAYMSYELATIKLDVELDSAPHELLKTEPDTDELTSLFGKLQFRRWLSEMLDGSDGKIVADEKASEP------------ 323
gi 147675220 241 GNAKLSYQLATIKCDVELEESPQTLLKQTPDRDALMSLYGKLTFKSWLTELLDGGTGIVTADEQTKTSsvtVSTAATHAA 320
gi 156972895 241 DNAMLSYELATIKLDVELEETPESLLKAEPSTDELIKLYGQLTFKSWLNELLEGGTGVVEADESTGAA----RGGSAASK 316
gi 28896881  241 DNAMLSYELATIKLDVELEETPESLLKAEPNKDELIKLYGQLTFKSWLNELLEGGSGTVEAVELAGSA---QASSSSSSH 317
gi 27364348  241 DNALLSYQLATIKLDVALQETPESLLKTEPNKDELIKLYGQLAFKSWLNELLEGGTGVVEADEKAQTS---VRSGASPVE 317
gi 37678370  267 DNALLSYQLATIKLDVALQETPESLLKTEPNKDELIKLYGQLAFKSWLNELLEGGTGVVEADEKAQTS---VRSGASPVE 343
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15640140  321 AIPESPAAHIDRSQYQTILNEQDFQLWLEKLKQAELFAFDTETDNLDYMVANLVGMSFAVAEGEAAYLPVAHDYLDAPQQ 400
gi 59710681  319 EEELIVAAQVDRSKYETILTKEAFSVWLDKLNNADVAAFDTETDSLDYMVANLIGLSFAVEEGEAAYVPVAHDYLDAPEQ 398
gi 54310556  324 VEKKVVAPTIDRSGYETILDEVSFKTWLDTLTAADVVAFDTETDSLDYMTANLVGVSFAVEEGKAAYVPVAHDYLDAPEQ 403
gi 147675220 321 AIPESPAAHIDRSQYQTILNEQDFQLWLEKLKQAELFAFDTETDNLDYMVANLVGMSFAVAEGEAAYLPVAHDYLDAPQQ 400
gi 156972895 317 ADMDTSAVKIDRSQYETILDEASFNAWLDKLKASELFAFDTETDSLDYMVANLVGLSFATDEGIAAYVPVAHDYLDAPQQ 396
gi 28896881  318 AEMETSAVTIDRSQYETILDEASFNAWLEKLKAAELFAFDTETDSLDYMVANLVGLSFAIDEGIAAYVPVAHDYLDAPEQ 397
gi 27364348  318 SEINNAAANIDRSQYQTIFDQATFDIWLDKLKASELFAFDTETDSLDYMVANLVGLSFAVAEGEAAYVPVAHDYLDAPEQ 397
gi 37678370  344 SEINNAAANIDRSQYQTIFDQATFDIWLDKLKASELFAFDTETDSLDYMVANLVGLSFAVAEGEAAYVPVAHDYLDAPEQ 423
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15640140  401 LERDWVIAQLKPLLEDESKAKVGQNLKYDASVMARYGVELRGIRHDTMLQSYVYNSVGGKHDMDSLALRFLQHSCISFEQ 480
gi 59710681  399 LDRDWVLEQLKPYLEDDNKAKVGQNLKYDASVLARYDIEMKGIKFDTMLESYVYNSVAGKHNMDSLALRYLQHNTISFEE 478
gi 54310556  404 LDRDWVLAQLKPLLEDPAQNKVGQNLKFDMSILARYDINMQGIKYDTMLESYVFNSVVGRHDMDSLALRYLEHKNISFEE 483
gi 147675220 401 LERDWVIAQLKPLLEDESKAKVGQNLKYDASVMARYGVELRGIRHDTMLQSYVYNSVGGKHDMDSLALRFLQHSCISFEQ 480
gi 156972895 397 LDRDWVLAQLKPILEDEAQAKVGQNLKYDASVLARYGIEMKGIKHDTMLASYVYNSVGGKHDMDSLALRFLQHSCISFEQ 476
gi 28896881  398 LDRDWVLEQLKPILEDDAQAKVGQNLKYDASVLARYGIEMKGIKYDTMLASYVYNSVGGKHDMDSLALRFLQHSCISFEQ 477
gi 27364348  398 LDRDWVLAQLKPLLEDDTKAKVGQNLKYDASVLARYGIEMKGIKHDTMLASYVYNSVGGKHDMDSLALRFLQHSCISFEQ 477
gi 37678370  424 LDRDWVLAQLKPLLEDDTKAKVGQNLKYDASVLARYGIEMKGIKHDTMLASYVYNSVGGKHDMDSLALRFLQHSCISFEQ 503
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15640140  481 VAGKGKNQLTFNQIALEEAAQYAAEDADVTLRLHQRIHPLIEQDAKLEQVYREIEMPLVPVLSRIERTGVMIDDMLLSAQ 560
gi 59710681  479 IAGKGKKQLTFNQIALEQAAPYAAEDADITLRLHHVLNAKLEADEKLKSVFTDIELPLVSVLSRMERKGVYIDDMLLSAQ 558
gi 54310556  484 VAGKGKKQLTFNQIDLDVAGPYAAEDADITLRLHNLLNEKVESDEQLKSVFEDIEMPLVPVLSRIERTGVLIDSMLLSAQ 563
gi 147675220 481 VAGKGKNQLTFNQIALEEAAQYAAEDADVTLRLHQRIHPLIEQDAKLEQVYREIEMPLVPVLSRIERTGVMIDDMLLSAQ 560
gi 156972895 477 IAGKGKNQLTFNQIDLDEASPYAAEDADVTLRLHNRLFANIEQDEKLKTVYEEIEMPLVPVLSRIERTGVLIDDMKLSAQ 556
gi 28896881  478 IAGKGKNQLTFNQIELEQASPYAAEDADVTLRLHNRLFANIEQDEKLKSVYEEIEMPLVPVLSRIERTGVLIDDMKLSAQ 557
gi 27364348  478 LAGKGKNQLTFNQIDLNEAAVYAAEDADVTLRLHNRLFANIEQDEKLNAIYQEIEVPLVPVLSRMERTGVLIDDMKLSAQ 557
gi 37678370  504 LAGKGKNQLTFNQIDLNEAAVYAAEDADVTLRLHNRLFANIEQDEKLNAIYQEIEVPLVPVLSRMERTGVLIDDMKLSAQ 583
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15640140  561 SQEIALRLDQLEQNAYELAGQPFNLSSPKQLQTILFEQMKLPVLQKTPSGTPSTNEEVLQELALDYPLPKVLIEYRGLAK 640
gi 59710681  559 SVEIGQRLDELEKAAFEVAGEEFNMNSPKQLQTILFEKMELPVIKKTPSGAASTNEEVLQELALDYPLPKLILEYRGLAK 638
gi 54310556  564 STEIAARLDELETKAYEIAEQEFNLSSPKQLQAILFEKMGLPILKKTPSGAPSTNEEVLQELALDYPLPKILLEYRGLAK 643
gi 147675220 561 SQEIALRLDQLEQNAYELAGQPFNLSSPKQLQTILFEQMKLPVLQKTPSGTPSTNEEVLQELALDYPLPKVLIEYRGLAK 640
gi 156972895 557 SVEIAARLDELEQKAYEIAEQEFNMNSPKQLQALLFEKMGLPVINKTPSGTPSTNEEVLQELALDYPLPKLILEYRGLAK 636
gi 28896881  558 SVEIAARLEELEQKAYEIAEQEFNMNSPKQLQAILFEKMGLPVVKKTPSGTPSTNEEVLQELALDYPLPKLILEYRGLAK 637
gi 27364348  558 SQEIAVRLGELEQKAYEIAGQPFNMNSPKQLQTILFEQMGLPVIKKTPSGTPSTAEEVLQELALDYPLPSVIMEYRGLAK 637
gi 37678370  584 SQEIAVRLGELEQKAYEIAGQPFNMNSPKQLQTILFEQMGLPVIKKTPSGTPSTAEEVLQELALDYPLPSVIMEYRGLAK 663
                        650       660       670       680       690       700       710       720
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15640140  641 LKSTYTDKLPKMINPSTGRVHTSYHQAVTATGRLSSTDPNLQNIPVRNEEGRRIRQAFVAPHGWKIMAVDYSQIELRIMA 720
gi 59710681  639 LKSTYTDKLPKMINPSTGRVHTSYHQAVTATGRLSSTDPNLQNIPIRNEEGRRIRQAFVAPHGWKILAVDYSQIELRIMA 718
gi 54310556  644 LKSTYTDKLPKMVNPSTGRVHTSYHQAVTATGRLSSSDPNLQNIPVRNAEGRRIRQAFIAPTGYKILAVDYSQIELRIMA 723
gi 147675220 641 LKSTYTDKLPKMINPSTGRVHTSYHQAVTATGRLSSTDPNLQNIPVRNEEGRRIRQAFVAPHGWKIMAVDYSQIELRIMA 720
gi 156972895 637 LKSTYTDKLPKMINPSTGRVHTSYHQAVTATGRLSSTDPNLQNIPIRNEEGRRIRQAFVAPTGYKILAVDYSQIELRIMA 716
gi 28896881  638 LKSTYTDKLPKMINPSTGRVHTSYHQAVTATGRLSSTDPNLQNIPIRNEEGRRIRQAFVAPAGYKVLAVDYSQIELRIMA 717
gi 27364348  638 LKSTYTDKLPKMINPHTGRVHTSYHQAVTATGRLSSTDPNLQNIPIRNEEGRRIRQAFVAPHGYKILAVDYSQIELRIMA 717
gi 37678370  664 LKSTYTDKLPKMINPHTGRVHTSYHQAVTATGRLSSTDPNLQNIPIRNEEGRRIRQAFVAPHGYKILAVDYSQIELRIMA 743
                        730       740       750       760       770       780       790       800
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15640140  721 HLSGDQALLDAFRDGKDIHAATAAEIIGVPIDQVSSEQRRRAKAVNFGLIYGMSAFGLAKQLGIPRGEAQEYMDKYFERY 800
gi 59710681  719 HLSQDKALLAAFSAGKDIHAATAAEVKGVSIEEVTSEDRRRAKAINFGLIYGMSAFGLAKQIGIPRGEAQDYMNVYFERY 798
gi 54310556  724 HLSGDKALLEAFKQGKDIHAATAAEILGLPIESVTTEQRRRAKAINFGLIYGMSAFGLAKQLDMGRNEAQDYMNVYFERY 803
gi 147675220 721 HLSGDQALLDAFRDGKDIHAATAAEIIGVPIDQVSSEQRRRAKAVNFGLIYGMSAFGLAKQLGIPRGEAQEYMDKYFERY 800
gi 156972895 717 HLSGDQALLDAFRDGKDIHAATAAEIMGVSIEDVSSEQRRRAKAVNFGLIYGMSAFGLAKQLGIPRGEAQAYMDKYFERY 796
gi 28896881  718 HLSGDQALLDAFRDGKDIHAATAAEIMGVSIDQVSSEQRRRAKAVNFGLIYGMSAFGLAKQLGIPRGEAQAYMDKYFERY 797
gi 27364348  718 HLSGDQALLDAFQQGKDIHAATAAEIMGVSIEQVSSEQRRRAKAVNFGLIYGMSAFGLAKQLGIPRGEAQAYMDKYFERY 797
gi 37678370  744 HLSGDQALLDAFQQGKDIHAATAAEIMGVSIEQVSSEQRRRAKAVNFGLIYGMSAFGLAKQLGIPRGEAQTYMDKYFERY 823
                        810       820       830       840       850       860       870       880
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15640140  801 PGVMQYMEDTRSRAAQLGYVETIFGRRLHLPEITSRNAMRRKAAERAAINAPMQGTAADIIKKAMLLVDEWIEREGDGRV 880
gi 59710681  799 PGVMQYMEETRLLATEQGYVETLYGRRLHLPEINARNGMRRKAAERAAINAPMQGTAADIIKKAMILVDEWVETEGKDRV 878
gi 54310556  804 PGVLEYMESTRIHASEQGYVETLFGRRLYLPDIKSRNGIRRKAAERAAINAPMQGTAADIIKRAMVLVDEWVEQQETGRV 883
gi 147675220 801 PGVMQYMEDTRSRAAQLGYVETIFGRRLHLPEITSRNAMRRKAAERAAINAPMQGTAADIIKKAMLLVDEWIEREGDGRV 880
gi 156972895 797 PGVMQYMEDTRSAASEQGFVETIFGRRLHLPEIQSRNGMRRKAAERAAINAPMQGTAADIIKKAMLLVDQWIQEEGNGRV 876
gi 28896881  798 PGVMQYMEDTRSAAADKGYVETIFGRRLHLPEIKSRNGMRRKAAERAAINAPMQGTAADIIKKAMLLVDQWIQEEGNGRV 877
gi 27364348  798 PGVMQYMEDTRSNAAQHGYVETIFGRRLHLPEITSRNVMRRKAAERAAINAPMQGTAADIIKKAMLLVDQWIQEEGNGRV 877
gi 37678370  824 PGVMQYMEDTRSNASQHGYVETIFGRRLHLPEITSRNVMRRKAAERAAINAPMQGTAADIIKKAMLLVDQWIQEEGNGRV 903
                        890       900       910       920       930
                 ....*....|....*....|....*....|....*....|....*....|....
gi 15640140  881 KLLMQVHDELVFEVKESSLSEIESKVQQLMESAAELAVPLVAEAGHGDNWEQAH 934
gi 59710681  879 NLLMQVHDELVFEVKEDALDEVTTKVRELMEQAAQLDVPLVAEAGFGNNWDEAH 932
gi 54310556  884 RLLMQVHDELVFEVQESELDAVSADVRRLMELAAELDVPLIADTGSGDNWDEAH 937
gi 147675220 881 KLLMQVHDELVFEVKESSLSEIESKVQQLMESAAELAVPLVAEAGHGDNWEQAH 934
gi 156972895 877 KLLMQVHDELVFEVEESSLSEIESKVQNLMESAAELKVPLVAEAGHGDNWDQAH 930
gi 28896881  878 KLLMQVHDELVFEVEESSLSEIESKVQKLMESAAELKVPLVAEAGHGDNWDQAH 931
gi 27364348  878 KLLMQVHDELVFEVEESCLTEIESKVQQLMESAAQLNVPLVAEAGHGDNWDQAH 931
gi 37678370  904 KLLMQVHDELVFEVEESCLTEIESKVQQLMESAAQLNVPLVAEAGHGDNWDQAH 957
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap