Conserved Protein Domain Family
PRK08768

?
PRK08768: PRK08768 (this model, PSSM-Id:103566 is obsolete)
3-oxoacyl-(acyl carrier protein) synthase II; Reviewed
Statistics
?
PSSM-Id: 103566
View PSSM: PRK08768
Aligned: 8 rows
Threshold Bit Score: -1
Threshold Setting Gi: 0
Created: 22-Jul-2008
Updated: 31-Jul-2008
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
21241884   1 MSRRVVVTGMGMVSPLGNDLATSWDGIVHGRSGIGPITQIDASQFTTKIAGEIKNFDPTLFVSAKDVKKMDSFIHYGVGA 80 
78046704   1 MSRRVVVTGMGMVSPLGNDLATSWDGIVHGRSGIGPITQIDASQFTTKIAGEIKNFDPTLFVSAKDVKKMDSFIHYGVGA 80 
58580506  22 MSRRVVVTGMGIVSPLGNDLATSWDGIVHGRSGIGPITQIDASQFTTKIAGEIKNFDPTLFVSAKDVKKMDSFIHYGLGA 101
84622465   1 MSRRVVVTGMGIVSPLGNDLATSWDGIVHGRSGIGPITQIDASQFTTKIAGEIKNFDPTLFVSAKDVKKMDSFIHYGLGA 80 
66769527   1 MSRRVVVTGMGMVSPLGNDLATSWDGIIHGRSGIGPIRQIDASQFTTRIAGEIKNFDPTQFVSAKDVKKMDSFIHYGVGA 80 
21230479   1 MSRRVVVTGMGMVSPLGNDLATSWDGIIHGRSGIGPIRQIDASQFTTRIAGEIKNFDPTQFVSAKDVKKMDSFIHYGVGA 80 
15837275   1 MNRRVVVTGMGMVSPLGNDLTTSWDGIVHGRSGIAPIVQIDASKLSTQIAGEIKGFDPMKFVSAKDAKKMDSFIYYGIGA 80 
28199381   1 MNRRVVVTGMGMVSPLGNDLTTSWDGIVHGRSGIAPIVQIDASKFPTQIAGEIKGFDPTKFVSAKDAKKMDSFIYYGIGA 80 
21241884  81 SFMALDDSGLEIDESNAERVGAILGSGIGGLLGIEEQTIKFHEGGARKISPFYVPSTIINMLPGQVSLIKGLKGPTFSAV 160
78046704  81 SFMALDDSGLEIDESNAERVGAILGSGIGGLLGIEEQTIKFHEGGARKISPFYVPSTIINMLPGQVSLIKGLKGPTFSAV 160
58580506 102 SFMALDDSGLEIDDSNAERVGAILGSGIGGLLGIEEQTIKFHEGGARKISPFYVPSTIINMLPGQVSLIKGLKGPTFSAV 181
84622465  81 SFMALDDSGLEIDDSNAERVGAILGSGIGGLLGIEEQTIKFHEGGARKISPFYVPSTIINMLPGQVSLIKGLKGPTFSAV 160
66769527  81 SFMALDDSGLEINESNAERVGAILGSGIGGLLGIEEQTIKLHEGGARKISPFYVPSTIINMLPGQVSLIKGLKGPTFSAV 160
21230479  81 SFMALDDSGLEINESNAERVGAILGSGIGGLLGIEEQTIKLHEGGARKISPFYVPSTIINMLPGQVSLIKGLKGPTFSAV 160
15837275  81 AFMALDDAGLEINEINAERVGALIGSGIGGVFGIEEQTIKFYEGGVRKISPFYVPSTIINMLPGQLSVLKGLKGPTFSAV 160
28199381  81 AFMALDDAGLEINEINAERVGALIGSGIGGVFGIEEQTIKLYEGGARKISPFYVPATIINMLPGQLSVLKGLKGPTFSAV 160
21241884 161 SACATSNHSIGTAMRMIQHGDADVMLAGGAERGSSPSSVGGFCAMKAMSTRNDDPAGASRPWDKQRDGFVLGDGAGVLVL 240
78046704 161 SACATSNHSIGTAMRMIQHGDADVMLAGGAERGSSPSSVGGFCAMKAMSTRNDDPTGASRPWDKQRDGFVLGDGAGVLVL 240
58580506 182 SACATSNHSIGTAMRMIQHGDADVMLAGGAERGSSPGSVGGFCAMKAMSTRNDDPTGASRPWDKQRDGFVLGDGAGVLVL 261
84622465 161 SACATSNHSIGTAMRMIQHGDADVMLAGGAERGSSPGSVGGFCAMKAMSTRNDDPTGASRPWDKQRDGFVLGDGAGVLVL 240
66769527 161 SACATSNHSIGTAMRMIQHGDADVMLAGGAERGSSPSSVGGFCAMKAMSTRNDDPTAASRPWDKQRDGFVLGDGAGVLVL 240
21230479 161 SACATSNHSIGTAMRMIQHGDADVMLAGGAERGSSPSSVGGFCAMKAMSTRNDDPTAASRPWDKQRDGFVLGDGAGVLVL 240
15837275 161 SACATSNHSIGMAMRMIQYGDADVMLAGGSERASSPTAIGGFCAMRAMSTRNDDPTGASRPWDKGRDGFVLGDGAGILVL 240
28199381 161 SACATSNHSIGMAMRMIQYGDADVMLAGGSERASSPTAIGGFCAMRAMSTRNDDPTGASRPWDKGRDGFVLGDGAGILVL 240
21241884 241 EEYEHAKARGARIYAELVGFGASSDAFHMTAPSEDGEGAARSMAAAMRDAKLNPEQIGYLNAHGTSTPLGDLAETMAMKR 320
78046704 241 EEYEHAKARGARIYAELVGFGASSDAFHMTAPSEDGEGAARSMAAAMRDAKLNPEQIGYLNAHGTSTPLGDLAETMAMKR 320
58580506 262 EEYEHAKARGARIYAELVGFGASSDAFHMTAPSEDGEGAARSMAAAMRDAKLNPEQIGYLNAHGTSTPLGDLAETIAMKR 341
84622465 241 EEYEHAKARGARIYAELVGFGASSDAFHMTAPSEDGEGAARSMAAAMRDAKLNPEQIGYLNAHGTSTPLGDLAETIAMKR 320
66769527 241 EEYEHAKARGARIYAELVGFGASSDAFHMTAPSEDGEGAARSMAAAMRDAKLNPEQIGYLNAHGTSTPLGDLAETMAMKR 320
21230479 241 EEYEHAKARGARIYAELVGFGASSDAFHMTAPSEDGEGAARSMAAAMRDAKLNPEQIGYLNAHGTSTPLGDLAETMAMKR 320
15837275 241 EEYEYAKARGARIYAELAGFGATSDAFHMTMPVEDGEGAARCMRIALQDAKVTPEQIDYLNAHGTSTPLGDLCETNAIKT 320
28199381 241 EEYEYAKARGARIYAELAGFGATSDAFHMTMPVEDGEGAARCMRIALQDARVTPEQIDYLNAHGTSTPLGDLCETNAIKT 320
21241884 321 ALGDHAYKTMVSSTKSMTGHLLGAAGGVEAIFSVMALHTGIIPPTINLEEPSEGCDLDYVPNVARQVQVDAVMSNGFGFG 400
78046704 321 ALGDHAYKTMVSSTKSMTGHLLGAAGGVEAIFSVMALHTGIIPPTINLEEPSEGCDLDYVPNVAREVQVDAVMSNGFGFG 400
58580506 342 ALGDHAYKTMVSSTKSMTGHLLGAAGGVEAIFSVMALHTGIIPPTINLEEPSEGCDLDYVPNVAREVQVDAVMSNGFGFG 421
84622465 321 ALGDHAYKTMVSSTKSMTGHLLGAAGGVEAIFSVMALHTGIIPPTINLEEPSEGCDLDYVPNVAREVQVDAVMSNGFGFG 400
66769527 321 ALGDHAYKTMVSSTKSMTGHLLGAAGGVEAIFSVMALHTGIIPPTINLEEPSEGCDLDYVPNVAREVQVDAVMSNGFGFG 400
21230479 321 ALGDHAYKTMVSSTKSMTGHLLGAAGGVEAIFSVMALHTGIIPPTINLEEPSEGCDLDYVPNVAREVQVDAVMSNGFGFG 400
15837275 321 VLGDHAYKVMVSSTKSMTGHLLGAAGGVEAIFSVMALHTGIVPPTINLEEPDEGCDLDYVPHVAREAKLDVVVSNGFGFG 400
28199381 321 VLGGHAYKVMVSSTKSMTGHLLGAAGGVEAIFSVMALHTGIVPPTINLEEPDEGCDLDYVPHVAREAKLDVVISNGFGFG 400
21241884 401 GTNGTLVFKRV 411
78046704 401 GTNGTLVFKRV 411
58580506 422 GTNGTLVFKRV 432
84622465 401 GTNGTLVFKRV 411
66769527 401 GTNGTLVFKRI 411
21230479 401 GTNGTLVFKRI 411
15837275 401 GTNGTLVFKRI 411
28199381 401 GTNGTLVFKRI 411
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap