Conserved Protein Domain Family
PRK08727

?
PRK08727: PRK08727 
hypothetical protein; Validated
Statistics
?
PSSM-Id: 181541
View PSSM: PRK08727
Aligned: 15 rows
Threshold Bit Score: 367.632
Threshold Setting Gi: 285018887
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
285018887   1 MSVPQLPLALRYPPEQRLDRYLGAPAGMLAHLQAVAAGVASDWVYLSGSTGTGKTHLALALCAAAEQAGRSAAYLPLQAA 80 
58580923    1 MSVPQLPLALRAPPDQRFDSYIAAPDGLLAQLQALAAGQVSDWLYLSGPAGSGKTHLALSLCAAAEQAGRMSAYLPLQAA 80 
84622858    1 MSVPQLPLALRAPPDQRFDSYIAAPDGLLAQLQALAAGQVSDWLYLSGPAGSGKTHLALSLCAAAEQAGRMSAYLPLQAA 80 
188578097   1 MSVPQLPLALRAPPDQRFDSYIAAPDGLLAQLQALAAGQVSDWLYLSGPAGSGKTHLALSLCAAAEQAGRMSAYLPLQAA 80 
21243683    1 MSVPQLPLALRAPPDQRFDSYIAAPDGLLAQLQALAAGQVSDWLYLSGPAGTGKTHLALSLCAAAEQAGRTPAYLPLQAA 80 
78048657    1 MSVPQLPLALRAPPDQRFDSYIAAPDGLLAQLQALAAGHVSDWLYLSGPAGTGKTHLALSLCAAAEQAGRTPAYLPLQAA 80 
15837192    1 MSVSQLPLALRYSSDQRFETYLHAPSGLIAQLRAVVDQCSRDWIYLVGASGSGKTHLALALCAAAEQVGQSVAYLPLQVA 80 
28199440    1 MSVSQLPLALRYSSDQRFETYLHAPSGLIAQLRALVDQCSREWIYLVGASGSGKTHLALALCAAAEQVGQSVAYLPLQVA 80 
170730815   1 MSVSQLPLALRYSSDQRFETYLHAPSGLIAQLRAVVDQCSRDWIYLVGASGSGKTHLALALCAAAEQVGQSVAYLPLQVA 80 
182682168   1 MSVSQLPLALRYSSDQRFETYLHAPSGLIAQLRALVDQCSREWIYLVGASGSGKTHLALALCAAAEQVGQSVAYLPLQVA 80 
285018887  81 TGRLPDALEALEGRHLVALDGLEAVAGQREDEVALFDFHNRARSAGVTLLYTAHAMPDGLALCLPDLHSRLAQCTRIVLP 160
58580923   81 AGRLRDALEALEGRSLVALDGVESIAGQRDDEVALFDFHNRARAAGITLLYTARQMPNGLALVLPDLRSRLSQCIRIGLP 160
84622858   81 AGRLRDALEALEGRSLVALDGVESIAGQRDDEVALFDFHNRARAAGITLLYTARQMPNGLALVLPDLRSRLSQCIRIGLP 160
188578097  81 AGRLRDALEALEGRSLVALDGVESIAGQRDDEVALFDFHNRARAAGITLLYTARQMPNGLALVLPDLRSRLSQCIRIGLP 160
21243683   81 AGRLRDALEALEGRSLVALDGVESIAGQRDDEVALFDFHNRARAAGITLLYTARQMPDGLALVLPDLRSRLAQCIRIGLP 160
78048657   81 AGRLRDALEALEGRGLVALDGVESIAGRRDDEVALFDFHNRARAAGITLLYTARQMPDGLALVLPDLRSRLSQCIRIGLP 160
15837192   81 VGRLRDALEALEGCLLVVLDGLQAIVGMREDEIALFDFHNRARAAGITLLYTARAIPDGLGLTLPDLRSRVAQCIRIALP 160
28199440   81 VGRLRDALEALEGCVLVVLDGLQAIVGMREDEIALFDFHNRARAAGITLLYTARAIPDGLGLTLPDLRSRVAQCIRIALP 160
170730815  81 VGRLRDALEALEGCLLVVLDGLQAIVGMREDEIALFDFHNRARAAGITLLYTARAIPDGLGLTLPDLRSRVAQCIRIALP 160
182682168  81 VGRLRDALEALEGCVLVVLDGLQAIVGMREDEIALFDFHNRARAAGITLLYTARAIPDGLGLTLPDLRSRVAQCIRIALP 160
285018887 161 PLEDADRAAVLRERAQRRGLVLEDAAIDWLLTHVGRDLTGLIGLLERLDRESLAAQRRVTLPFLRRVLQRSAS 233
58580923  161 VLDDAARAAVLRDRAQRRGLAMDEAAIDWLLTHGERELARLVALLDRLDRESLAAKRRITVPFLRRVLEDRRS 233
84622858  161 VLDDAARAAVLRDRAQRRGLAMDEAAIDWLLTHGERELARLVALLDRLDRESLAAKRRITVPFLRRVLEDRRS 233
188578097 161 VLDDAARAAVLRDRAQRRGLAMDEAAIDWLLTHGERELARLVALLDRLDRESLAAKRRITVPFLRRVLEDRRS 233
21243683  161 VLDDAARAAVLRDRAQRRGLALDEAAIDWLLTHSERELAALVALLDRLDRESLAAKRRITVPFLRRVLEDRGS 233
78048657  161 VLDDAARGAVLRDRAQRRGLALDEAAIDWLLTHSERELAGLVALLDRLDRESLAAKRRITVPFLRRVVAGMPG 233
15837192  161 TLDDVGRASVLRERAQRRGLMLDEAAIEWLLSRGDRDLGSLVMLLERLDRESLATKRRVTIPFLRHVLAEGGG 233
28199440  161 TLDDVGRASVLRERAQRRGLMLDEAAIEWLLSRGDRDLGSLVMLLERLDRESLATKRRVTIPFLRHVLAEGGG 233
170730815 161 TLDDVGRASVLRERAQRRGLMLDEAAIEWLLSRGDRDLGSLVMLLERLDRESLATKRRVTIPFLRHVLAEGGG 233
182682168 161 TLDDVGRASVLRERAQRRGLMLDEAAIEWLLSRGDRDLGSLVMLLERLDRESLATKRRVTIPFLRHVLAEGGG 233
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap