Conserved Protein Domain Family
PRK08583

?
PRK08583: PRK08583 
RNA polymerase sigma factor SigB; Validated
Statistics
?
PSSM-Id: 236306
View PSSM: PRK08583
Aligned: 62 rows
Threshold Bit Score: 414.092
Threshold Setting Gi: 42780162
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 229917800   1 MPAKSQQRHHSDDEVLEWIERYQQDDqNEEVQMLLINRYSDLVEALARKFSRGRAIHDDLVQVGMIGLLAALRRFDPEFG 80
gi 296501716   1 MEIQSQPTNLTKEDVIKLIADFQQNQ-CDEAQERLVEHYKNLVYSIAYRYSKGGPMHEDIIQVGMLGLLGAIRRYDYSIG 79
gi 163938900   1 MEIQSQPTDLTKEDVIKLIAEFQQNQ-CDEAQERLVNHYKNLVYSIAYRYSKGGPMHEDIIQVGMLGLLGAIRRYDYSIG 79
gi 42780162    1 MEIQSQPTTLTKEDVMKLIAEFQQNQ-CDEAQERLVEHYKNLVYSIAYRYSKGGPMHEDIIQVGMLGLLGAIRRYDYSIG 79
gi 30019159    2 MEIQSQPTNLTKEDVIKLIADFQQNQ-CDEAQERLVEHYKNLVYSIAYRYSKGGPMHEDIIQVGMLGLLGAIRRYDYSIG 80
gi 52144331    2 MEIQSQPTNLTKEDVIKLIAEFQQNQ-CGEAQERLVDHYKNLVYSIAYRYSKGGPMHEDIIQVGMLGLLGAIRRYDYSIG 80
gi 222094730   1 MEIQSQPTTLTKEDVMKLIAEFQQNQ-CDEAQERLVEHYKNLVYSIAYRYSKGGPMHEDIIQVGMLGLLGAIRRYDYSIG 79
gi 218232670   1 MEIQSQPTNLTKEDVIKLIADFQQNQ-CDEAQERLVNHYKNLVYSIAYRYSKGGPMHEDIIQVGMLGLLGAIRRYDYSIG 79
gi 217958581   1 MEIQSQPTTLTKEDVIKLIAEFQQNQ-CDEAQERLVEHYKNLVYSIAYRYSKGGPMHEDIIQVGMLGLLGAIRRYDYSIG 79
gi 225862940   1 MEIQSQPTNLTKEDVIKLIAEFQQNQ-CGEAQERLVNHYKNLVYSIAYRYSKGGPMHEDIIQVGMLGLLGAIRRYDYSIG 79
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 229917800  81 RSFESFAVPTIIGEIKRFIRDKTWSVHVPRRIKELGPKIKKTVEELTTELQRSPRIDEIADHLGVSDEEILETLEMGKSY 160
gi 296501716  80 NAFEPFAIPTIVGEIKKYLRDKTWGIHVPRRIKDLGGKIKLAIEELTDHLQRSPKIIEIANHLGLSEEEVLEIMDAKNNY 159
gi 163938900  80 NAFEPFAIPTIVGEIKKYLRDKTWGVHVPRRIKDLGGKIKLAIEELTDHLQRSPKIIEIANHLGLSEEEVLEIMDAKNNY 159
gi 42780162   80 NAFEPFAIPTIVGEIKKYLRDKTWGIHVPRRIKDLGGKIKLAIEELTDQLQRSPKIIEIADHLELSEEEVLEIMDAKNNY 159
gi 30019159   81 NAFEPFAIPTIVGEIKKYLRDKTWGIHVPRRIKDLGGKIKLAIEELTDHLQRSPRIIEIANHLGLSEEEVLEIMDAKNNY 160
gi 52144331   81 NAFEPFAIPTIVGEIKKYLRDKTWGIHVPRRIKDLGGKIKLAIEELTDHLQRSPKIIEIADHLGLSEEEVLEIMDAKNNY 160
gi 222094730  80 NAFEPFAIPTIVGEIKKYLRDKTWGIHVPRRIKDLGGKIKLAIEELTDRLQRSPKIIEIADHLGLSEEEVLEIMDAKNNY 159
gi 218232670  80 NAFEPFAIPTIVGEIKKYLRDKTWGIHVPRRIKDLGGKIKLAIEELTDRFQRSPKIIEIADHLGLSEEEVLEIMDAKNNY 159
gi 217958581  80 NAFEPFAIPTIVGEIKKYLRDKTWGIHVPRRIKDLGGKIKLAIEELTDRLQRSPKIIEIADHLGLSEEEVLEIMDAKNNY 159
gi 225862940  80 NAFEPFAIPTIVGEIKKYLRDKTWGIHVPRRIKDLGGKIKLAIEELTDHLQRSPKIIEIADHLGLSEEEVLEIMDAKNNY 159
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 229917800 161 QALSVDSSIEADNEGSTVTLLDLVGSQERGYESVDQRLILEKAFNVLNERERAILECAYYKNMSQKETGELLGISQMHVS 240
gi 296501716 160 RVSSLDDVVENSSDGSSVARIESVGEVEQGYEETERRLVLKDIFNVLNDTEKSVIHYIFGENLNQKDTGERLGISQMHVS 239
gi 163938900 160 QVSSLDDVVENSSDGSSVARIESVGEVEQGYEQTERRLVLDDIFNVLNDTEKSVIHYIFGENLNQKDTGERLGISQMHVS 239
gi 42780162  160 RVSSLDDVVENASDGSSVARIESVGEVEQGYEETERRLVLKDIFNVLNETEKSVIHYIFEENLNQKDTGERLGISQMHVS 239
gi 30019159  161 RVSSLDDVVENSSDGSSVARIESVGEVEQGYEETERRLVLKDIFNVLNDTEKSVIHYIFGENLNQKDTGERLGISQMHVS 240
gi 52144331  161 RVSSLDDVVENASDGSSVARIESVGEVEQGYEQTERRLVLEDIFNVLNETEKSVIHYIFEENLNQKDTGERLGISQMHVS 240
gi 222094730 160 RVSSLDDVVENASDGSSVARIESVGEVEQGYEETERRLVLKDIFNVLNDTEKSVIHYIFGENLNQKDTGERLGISQMHVS 239
gi 218232670 160 RVSSLDDVVENSSDGSSVARIESVGEVEQGYEETERRLVLKDIFNVLNDTEKSVIHYIFGENLNQKDTGERLGISQMHVS 239
gi 217958581 160 RVSSLDDVVENASDGSSVARIESVGEVEQGYEETERRLVLKDIFNVLNDTEKSVIHYIFGENLNQKDTGERLGISQMHVS 239
gi 225862940 160 RVSSLDDVVENASDGSSVARIESVGEVEQGYEETERRLVLKDIFNVLNETEKSVIHYIFEENLNQKDTGERLGISQMHVS 239
                        250
                 ....*....|....*.
gi 229917800 241 RLQRRALEKLREAIKV 256
gi 296501716 240 RIKRQAISKLKQAAFL 255
gi 163938900 240 RIKRQAISKLKQAAFL 255
gi 42780162  240 RIKRQAISKLKQAAFL 255
gi 30019159  241 RIKRQAISKLKQAAFL 256
gi 52144331  241 RIKRQAISKLKQAAFL 256
gi 222094730 240 RIKRQAISKLKQAAFL 255
gi 218232670 240 RIKRQAISKLKQAAFL 255
gi 217958581 240 RIKRQAISKLKQAAFL 255
gi 225862940 240 RIKRQAISKLKQAAFL 255
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap