Conserved Protein Domain Family
PRK08434

?
PRK08434: PRK08434 (this model, PSSM-Id:103420 is obsolete)
DNA polymerase I; Provisional
Statistics
?
PSSM-Id: 103420
View PSSM: PRK08434
Aligned: 14 rows
Threshold Bit Score: -1
Threshold Setting Gi: 0
Created: 22-Jul-2008
Updated: 31-Jul-2008
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 78777442    2 SKTVTIIDTFGFFFRSFYALPQhLKNSQGFPTGLLTGFTNFISTLQKQHDSDYIVFAIDTKGDSFRKEIDPNYKANRQPP 81
gi 154175515   1 MKTLTIIDTFGFFFRLYYAMPN-LKNRDGKPSGMISGFANFILNLKNEFPSDYIIFALEGKGETLRHKIAGDYKANRSEA 79
gi 118474622   1 MKSLTIIDTFGFFFRLYYAMSG-LKSQSGKPSGMVHGFANFIYNLKQDFPSDYIVFALDSGGKTFRSQIDPNYKANRVSP 79
gi 154148288   1 MKTLTIIDTFGFFFRLFYALSS-LKNKDGKPSGMISGFANFIANLKNEFNSDYIVFALDSKGKTFRSDIDPNYKANRPEP 79
gi 153951516   1 MKTLTIIDTFGFFFRLYYALKG-FKNSQGQASGMVSGFANFIYGLKNEYKSDYIIFALDSKGKTFRSEIDPSYKQNRTPP 79
gi 157414635   1 MKTLTIIDTFGFFFRLYYALKG-FKNSQGQASGMISGFANFIYSLKNEHKSDYIVFALDSKGKTFRSEIDPNYKQNRTPP 79
gi 15791706    1 MKTLTIVDTFGFFFRLYYALKG-FKNSQGQASGMISGFANFIYSLKNEYKSDYIVFALDSKGKTFRSEIDPNYKQNRTPP 79
gi 32266816    1 MNTLSVIDTFGFFFRSFYALPP-LKNKEGFPTGLLVGFCNLLQSLYKDPSCTYLAFALEGGGENKRRQIYDAYKRNRQPP 79
gi 152990932   1 MQTLTIIDTFGFFFRSYYALPP-LKSKKGFPTGLLTGFINFINSLVSEERSDYIVFALDSEGPSFRAKIDSEYKAQRPEP 79
gi 152992904   1 MKTITIIDTFGFFFRSYYALPP-LRNSEGFPTGLLTGFINLVDSLHRDHGTDYLVFALDSKGPTFRNEIYPEYKANREAP 79
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 78777442   82 PQELSMQLPIAIEWIDKMGYKTLGFDGYEADDVIATVVRFAKEKSYNVRVVSHDKDLFQLIDDGRVVLVDAIKKQVMDED 161
gi 154175515  80 PAALKEQLPVCIEMIEKMGLCAISREGYEADDIIATAVRLAKSQDVFVRVVTHDKDLYQLIEDGKVSIYSPLSKIEHDTA 159
gi 118474622  80 PQELKDQLPVCIDMIEKMGLCSLRVEGYEADDIIASFIKNSKDQDLEIRIVTHDKDLYQLIDDR-VSIFSPAKKELYNRD 158
gi 154148288  80 PKALLDQLPVCIEMIEKMGLCSFCQEGYEADDIIASFVKKY-SKNMQINIVTHDKDLYQLIGEN-VRVYSPAKKMLYDRD 157
gi 153951516  80 PPELLEQIPICIEMIEKMGFISVSREGYEADDIIASFVKTCENKDIFVRIITQDKDLYQLIKDGKTSIYSPISKNDYDEV 159
gi 157414635  80 PPELLEQIPICIEMIEKMGFISVSQEGYEADDIIASFVRTCEDRDIFVRIITQDKDLYQLIKDGKTSIYSPISKNDYDEA 159
gi 15791706   80 PPELLEQIPICIKMIEKMGFISVSQEGYEADDIIASFVKTCENRDIFVRIITQDKDLYQLIKDGKTSIYSPISKNDYDEA 159
gi 32266816   80 PQELLMQLPIAIEWIEKMGFLNISIEGYEADDVIASINKVANAQNIVVRIISHDKDLYQLI-DENTYIYDPIGKRDIREA 158
gi 152990932  80 PEELKMQLPVAIKWIQEMGFKTLAKEGFEADDIIASLVKCAKEQGIKVKIVSHDKDLYQLIDDGKVVLYDPIKKEEIDEE 159
gi 152992904  80 PEDLTKQLPVAIRWVEKMGFANLAKEGFEADDIITTVTKFAREQDMKVKVVSHDKDLYQLIDDGLVVMYDSIKRKEIDEA 159
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 78777442  162 ECFKKYGISPKQFIDYQSILGDSADNIPGVKGIGKVGAEKLLIEYETLDNIYAN---IENIKPLGIQKKLLEFKEQAYMS 238
gi 154175515 160 SCVEKYGVRPEQIRDFLAIAGDSSDNIPGVKGIGAVGAKKLLAEFGSLEAIYEN---LALVRNERTREMLAAGRESAFLS 236
gi 118474622 159 GCYEKYGVYPEQIRDFLALCGDSADNIPGVKGIGEKGAKKLLDEFGSIENLYEN---LSQVRNERTKNMLFESKENAFIS 235
gi 154148288 158 GCFEKYGVWPEQVRDFLGICGDSADNIPGIKGIGEKGAKKLLENFGSLEKIYEN---IDNLPQNRQKDLLIEGKENAFMS 234
gi 153951516 160 ACLEKYGVKPNQIRDFLALCGDNSDNIPGVKGIGAKGAKTLLDEFGSIEGIYEN---LTLIRNERSRNLLLEGKENAFLS 236
gi 157414635 160 ACLEKYGVKPHQIRDFLALCGDSSDNIPGVKGIGAKGAKTLLDEFGSIEGIYEN---LTLVRNERSRNLLLEGKENAFLS 236
gi 15791706  160 ACLEKYGVKPNQIRDFLALCGDSSDNIPGVKGIGAKGAKTLLDEFGSIEGIYEN---LTLVRNERSRNLLLEGKENAFLS 236
gi 32266816  159 ECLYKYGVNPKNFIDYQSLVGDTSDNIVGIKGIGAKSAQKLITHFGSIESLYEReseLEEVVTPRIAHLLREGKNNAFLS 238
gi 152990932 160 KATKKFGIPPKLIKDYLALVGDSADNIPGVKGIGPKTAVKLLEQFGSLEGIYEH---LDEVKPERIKKLLIEGKEKAFLS 236
gi 152992904 160 ACIEKFGVNPKDFVDFQAIVGDASDNVPGVKGIGVKGAAKLINEFHTLENIYAN---IEKCGTPRIQKLLLEYKESAFLS 236
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 78777442  239 KKLVTLSCSVFESFDFEEFKMDIENPFLNIYDELVKYEQNGILRALNAKNlvhvea------------vkkveAEAQTNK 306
gi 154175515 237 KRLTTLFDDAPDMVDFADAPFPQQNPLLKVADMLREFDLSRVLKSLQN-------------------------SGENAEF 291
gi 118474622 236 KRLATLYDEL-ETPNLQNAIFPTSNPLLKVIDTLKDYSLSRLLATL---------------------------KSSDEDK 287
gi 154148288 235 KKLASLYDGLEVPDLLG-AEFPTENPLLKITEILKEYNLNRILSALE--------------------------NSKDTDK 287
gi 153951516 237 KKLASLYENLEVQDLIEKATYPDEEPLLKILEILEHYELNTLLKKLRQ-------------------------NPDNKDK 291
gi 157414635 237 KKLASLYENLEVQDLIEKATYPDEEPLLKILEILEHYELNTLLKKLRQ-------------------------NPDNKDK 291
gi 15791706  237 KKLASLYDNLEVQNLIEKATYPDEEPLLKILEILEHYELNTLLKKLRQ-------------------------NPDNKDK 291
gi 32266816  239 KKLVTLYDDLLENIDLSKCLMPESNPMLKILDELKKYDLKNIISKVQSPHeryaqkrsaqkgigslndmpdviESSSSAQ 318
gi 152990932 237 KKLVELDENVFDHCNLQQFHLPSINPIIKIADELIDYDITAILRKIKAAP-----------------------LQQSKKQ 293
gi 152992904 237 RELVKMRDDVYDDLDLSKFVFEERNYLSCLIDEFEKYEMKRALQKAKVGQsevgc--------------hdiaPPKLKTP 302
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 78777442  307 KVNFRAVLIDDAKELKRVLSELRDDTIVAFDTETTGLDYENDSLVGFSFCFNEDEAYYVPIAHFYLGVGEQISQEDAKIA 386
gi 154175515 292 KLGFNANLLTDESAIESLLANITEETIIAFDTETTDIDTQSAKLVGFSFCFNDENAYYVPVAHSYLGAPKQVGTDFAAWA 371
gi 118474622 288 ILSFTPVLLTDESELIRLLEDMNSEIMISFDTETTSTDAKIAKIVGFSFCFNEQTSYYVPLAHSYLGVESQISMNSAKWA 367
gi 154148288 288 TLNFKAITVSTKEQADKILNDLENVKEIAFDTETTSVDSHNAKIVGFSFCWDEKSSFYVPLAHSYLGAPDMLDKNIAKRL 367
gi 153951516 292 NLGFKATLIQDENKLFEILNTLDKESIIAFDTETTGLDTKEAKIVGFSFCMSENEAFYVPLTHNYLGVSKQISLESAKKA 371
gi 157414635 292 NLGFKATLIQDENKLFEILNTLDKESIIAFDTETTGLDTKEAKIVGFSFCMSENEAFYVPLTHNYLGVGEQISLQSAKKA 371
gi 15791706  292 NLGFKATLVQDENKLFEILNTLDKESIIAFDTETTGLDTKEAKIVGFSFCMNENEAFYVPLTHNYLGVGEQISLQSAKKA 371
gi 32266816  319 SFSFKAHLLDNFTALEAVLDSIPSGAKIGFDCESDSLNMQEANLVGFSFCFDGENAYYVPVGHHYLGVGCQLTHTQAKIA 398
gi 152990932 294 SVQFEAICLDTYDKLIKAIQSIPEGALVAFDTETDDLDTKKANLVGFSFAYSEEKAYYVPIGHNYLGVGDQVGLDKALEA 373
gi 152992904 303 LLTFESITLDTKEKLNEVIDELSKDTLVAFDTETTGLDTRTDKMVGFSFCTSNEKAYYVPVGHSYLGVEEQVDPEDAVAA 382
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 78777442  387 IKKIFNSRVVGHNIKFDLHFVIRFLGEGElDIFADSMILAWLINPESALSLDKLSEKLLEHKMITFKESVKKGETFASVA 466
gi 154175515 372 VGQIYKGCVVGQNLKYDFKVVKRNLGLEPpVKFKDTMVLAWLADPSQAVGMDALAKRLYNYDTIKFEDVVRRGETFASVP 451
gi 118474622 368 ISQIYKGFVIGQNLKYDFRIVANNFGIEPpKNYSDTMILAWLDDPSSSVGMDNLAKKLYNYETIKFESVVKKGEDFSSVD 447
gi 154148288 368 IEAIYTKFIIGQNLKYDFRIVRNNFGLNPpAKYADTMILAWLMDPDNSVGMDNLAKRYFDYDTIKFENVVKKGENFSSVD 447
gi 153951516 372 IELIFNHFVIGHNLKYDFKIIQNNFGLNLpQKYADTMILAWLKNPSLRVNMDDLALRLFNYETLHFESLVKKGENFASVE 451
gi 157414635 372 IEVIFNHFVIGHNLKYDFKIIQNNFGLNLpQKYADTMILAWLKNPSLRVNMDDLALRLFNYETLHFESLVKKGENFASVE 451
gi 15791706  372 IEVIFNHFVIGHNLKYDFKIIQNNFDLNLpQKYADTMILAWLKNPSLRVNMDDLALRLFNYETLHFESLVKKGENFASVE 451
gi 32266816  399 LKRIFTYPLIGHNLKFDLSLIFHTLELEHtGEIYDSMILGWLYDSIAPIGLDKQMLKWFNHTMISFDSVVAKDENFSQVN 478
gi 152990932 374 ISKIFEHTIIGHNLKFDLSLLYR-YGIDEkKDIVDTMILAWLVDPGSSVGLESVAKRFLDHDMIAYKETVKKGEDFSQVS 452
gi 152992904 383 LKKLMKQKIVGQNLKFDLSLLYNQYGMEEvLPFADTMIMAWLTDPGSRVGLDSLAQKFFKYDMKPFKEMVKKGENFSHVN 462
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 78777442  467 LEEACNYAAEDAYITLRLYYLFLEMLKDQGAEHLIEEAKEVEFPFIKTLLKMEMHGIELNSLFLEQFLAEAKDSLSELTK 546
gi 154175515 452 LENAAKYAAEDAWITLKFYKSFLNLLD----PALIELANAHEFPFILTLFDMESVGIAINKKKMQNLILQNDAKIKILTS 527
gi 118474622 448 LQSASKYASEDAWITLKFYKTFTNKLE----ESMLNIAKNVEFPFILTLFDMESNGIRLNLEKLRALILRNDSALRALTT 523
gi 154148288 448 VKNAANYASEDAWITLKFYKKFCGILS----TELLDLAKNLEFPFIKVLLNMEENGIKMDISSLKEMINEIAEQLKILTN 523
gi 153951516 452 LEKACKYAAEDAYITLRFYLYFLKNLE----IPLLELAKNCEFDFIKIIMMMEENGIKLDTNALEALMKKFENEIKILSE 527
gi 157414635 452 LEKACKYAAEDAYITLRFYLYFLKNLE----TPLLELAKNCEFDFIKIIMMMEENGIKLDTNALEILMKKFENEIKNLSE 527
gi 15791706  452 LEKACKYAAEDAYITLRFYLYFLKNLE----TPLLELAKNCEFDFIKIIMMMEENGIKLDTNALEILMKKFENEIKNLSE 527
gi 32266816  479 IAAATQYAAEDAIATFRLYHRLEEVFYKREWSSILELANKLEYPFIKVLLAMECEGIKVDIPLLESLKEKASEHISQLSA 558
gi 152990932 453 IDAACKYASEDAVITYMVYFKLLDALRKQGASHLIDEAKKVEFPFVNTLIHMEQAGIKIDIPFFEELKSSLEKRIDEITQ 532
gi 152992904 463 IADATFYAAEDAWMTFLLYGAIKKKMELSSLTHLLKEAKDVEYPFINVLIRMERLGIKVDQVKLETLKKTLSEDLHRLTS 542
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 78777442  547 KIYELASLEFNINSTQQLGNVLFEQLGLPTSKKTKTGYSTDEKVLNSLLGEHEIIPYLLEYREVYKLYSTYIEPLLKLSQ 626
gi 154175515 528 EIYELTGENFNINSVKQLGAVLFEHLKLPVKKKTKTGYSTDEAVLAELIDAHLVIAKLLEYRELYKLQSTYCEPLLNLAN 607
gi 118474622 524 EIYELCEQRFNINSSKQLGSVLFDYLKLPAKKKTKTGYSTDESVLSELLDLHPSIEKILEYRELYKLQSTYCEPLLNLAI 603
gi 154148288 524 EIYDLSGENFNINSTKQLGEVLFEHLGLPAKKKTKTGYSTNESALSAISELHAVVPKILAYRELYKLQSTYTEPLLALAL 603
gi 153951516 528 EIYTLCEDRFNLNSPKQVGDILFEKLKLPSGKKGKTGYSTDEKVLHALLDKHPVITKILDYRELAKLYSTYCEPLLKLAL 607
gi 157414635 528 EIYTLCEDRFNLNSPKQVGDILFEKLKLPSGKKGKTGYSTDEKVLNALLDKHPVIAKILDYRELAKLYSTYCEPLLKLAL 607
gi 15791706  528 EIYTLCEDRFNLNSPKQMGDILFEKLKLPSGKKGKTGYSTDEKVLNILLDKHPVIAKILDYRELAKLYSTYCEPLLKLAL 607
gi 32266816  559 QIFELCGETFNLNSPQQLAHILFNRLGLKAGRSVKGGLSTDERTLLAIIDAHPVIALILDYREVNKLKSTYIEPLLRFGS 638
gi 152990932 533 KIYEYAGGEFNINSTKQLAAILFEKLKLPPLKKTKSGYSTNETTLQALKDKHPIIPLLLEYRELYKLKSTYIDPLINYAK 612
gi 152992904 543 EIHELSGSEFNIRSTQQLGVVLFQHLGLKGGKKTKTGYSTNEAVLQSLKHEHPVIGKILEYREYHKMLSTYVEPLLKLAK 622
                        650       660       670       680       690       700       710       720
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 78777442  627 QDKESRIHTSFVQTGTTTGRLSSKNPNLQNIPTRTALGTKIREAFVAPEGKKLIGIDYSQIELRLLAHFTQDRVLVEAFM 706
gi 154175515 608 KDENSRIYTNFVQTGTSTGRLASKNPNLQNIPARGSLAKDVRETFEAKEGYSFVGLDYSQIELRLLAHFSRDEALLKAFE 687
gi 118474622 604 KDENHRVYTNFIQTGTATGRLSSKNPNLQNIPARGNLAKDMRAVFEPKDGYSLISLDYSQIELRLLAHFSCDPALIEAFK 683
gi 154148288 604 KNDENRIFSNFLQTGTSTGRLSSKNPNLQNIPAHGSMAVQMRNCFVSKDGFSFVGLDYSQIELRLLAHFSLDKELLRAFR 683
gi 153951516 608 KDKNSRIYSSFLQTGTATGRLSSKDPNLQNIPAHGQYAKDYKSCFVAKDGFSFTSLDYSQIELRMLAHFSEDEKLLNAFT 687
gi 157414635 608 KDKNSRIYSSFLQTGTATGRLSSKDPNLQNIPAHGQYAKDYKSCFVAKDGFSFISLDYSQIELRMLAHFSEDEKLLNAFA 687
gi 15791706  608 KDKNSRIYSSFLQTGTATGRLSSKDPNLQNIPAHGQYAKDYKSCFVAKDGFSFISLDYSQIELRILAHFSEDEKLLNAFA 687
gi 32266816  639 ANDKHRIYTSFLQSGTATGRLSSKSPNLQNIPVRREEGRKIRQAFISKEGHSLISIDYSQIELRLLAHFCKDSSLIESFK 718
gi 152990932 613 RDPKHRIYTSFIQTGTATGRLASKNPNLQNIPIKTELGRKIRYGFIAGEGRLLIGIDYSQIELRLLAHFSKDPALLEAFQ 692
gi 152992904 623 KDEKSRIYTSFIQTGTATGRLSSKDPNLQNIPVRSTLGRSVREAFVAKEGYKLVSIDYSQIELRLLAHFSKDAALMEAFN 702
                        730       740       750       760       770       780       790       800
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 78777442  707 QDKDIHMQTAIALFGEEDAPLKRNVAKTVNFGLLYGMGQKKLSETLKITTAEAKEIIERYFSSFPSVKSYFRSIVDFSKE 786
gi 154175515 688 NDEDIHARTAISIFGSADGQ-NRAVAKSINFGLIYGMGSSKLAGQVNISRAEAKEYIERYFKAFPTIKGFLEGIKTAAKN 766
gi 118474622 684 NGDDIHARTAISIFGESNTQ-NRAIAKSINFGLIYGMGSNKLSNELSIDKKSAKEYIDRYFKAFSTIKDFLDSIKNRAKN 762
gi 154148288 684 EDEDIHSRTAISIFGTSDKE-KRAVAKTINFGLIYGMGASKLSNELGISRSDAKDYIEKYFKAFASIKNFMENLKSEAKK 762
gi 153951516 688 NDEDIHARTAIMIFGESNYE-TRSVAKSINFGLIYGMGYKTLSQNLKIEAHLAKSYIEKYFENFTSIKKYFETVKNEAKQ 766
gi 157414635 688 NDEDIHARTAIMIFGESNYE-TRSVAKSINFGLIYGMGYKTLSQNLKIEAHLAKSYIEKYFENFTSIKKYFETVKNKAKQ 766
gi 15791706  688 NDEDIHARTAIMIFGESNYE-TRSVAKSINFGLIYGMGYKTLSQNLKIEANLAKSYIEKYFENFTSIKKYFEKVKNEAKQ 766
gi 32266816  719 QDKDIHFETAARLFGVELAAQKRAIAKSINFGLIYGMGSKKLAQTLQISLKEAKNYIESYFALFPTIKNFLNAQKEFLLE 798
gi 152990932 693 KGRDIHMETAIKLFGKEHAKEKRNIAKSINFGLIYGMGSRKLAETLGISTKEAKAIIESYFASFPTVKSYLESVENFAKT 772
gi 152992904 703 KGTDIHMATAVKLFGEEEAKAKRNFAKSVNFGLLYGMGPKKLSDELGITSAEAKEIIANYFASFPTVKNFLEGIQERVKI 782
                        810       820       830       840       850       860       870       880
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 78777442  787 AGYVETLLKRRRYFDYESASPMFRAAYEREAVNSIFQGSASDIIKLSMNKIHKLIEDEklNAKMLLQIHDELIFEVDTSE 866
gi 154175515 767 EGFVRTLLGRKRFFDFTNATPMQTAMYEREAVNTIFQGSAADIIKLAMVKIRPLCSV---RAKMLLQIHDELIFEVADEH 843
gi 118474622 763 DGFVETLIGRKRYFDFGGATPMQLAMFEREAVNTKFQGSAADIIKIAMIKVKDLLND---DAKMLLQIHDELIFEVRDEI 839
gi 154148288 763 NGYTTTLFGRKRYFDFANATPMQFAMYERESVNTKFQGSAADIIKKAMVEISPFLNE---NTRLLLQIHDELIFEVRDDM 839
gi 153951516 767 NGFITTLSGRKRYFDFENAKPMQIAMYERESINSILQGSAADIIKLAMLEINKELNE---DKKLILQIHDELIFEVKDDL 843
gi 157414635 767 NGFITTLSGRKRYFDFENAKPMQIAMYERESINSILQGSAADVIKLAMLEINKELNE---DKKLILQIHDELIFEVKDDL 843
gi 15791706  767 NGFIVTLSGRKRYFDFENAKPMQIAMYERESINSILQGSAADVIKLAMLEINKELNE---DKKLILQIHDELIFEVKDDL 843
gi 32266816  799 NGYSQTLLGHRRYFDFKNATDFMKANFLREGINSIFQGSAADLIKLSMCEIHKRYGHS--DFKMLLQVHDELIFEAPQEK 876
gi 152990932 773 HGYVETLLKRRRYFDFAHASGAQLAAYLREATNTVFQGSAADLIKMAMNKIKNVIDEKqlEAKILLQIHDELIFEVQENQ 852
gi 152992904 783 DGYVETLLKRRRIFDYENANGMQKAAYMRESVNTVFQGSAADLIKLSMNDIDSMIIDEalEAHMLLQIHDELIFEIREDQ 862
                        890       900       910
                 ....*....|....*....|....*....|....*.
gi 78777442  867 AEILGEKFKNIMQNIMPLNIPLKASMKIGDKWSELK 902
gi 154175515 844 AAEFGEAAQKIMQEIYKLNVPLKTSLNVAKNWGELK 879
gi 118474622 840 APSFAKNVQELMQTVVALNVPLVANWGMAKNWGDLK 875
gi 154148288 840 SESFGKKMQEIMQNVVKLNVPLKTSLSINKRWGDLK 875
gi 153951516 844 CENFVKKTRDIMENIVKLKVKLKTSSSIAKNWGDLK 879
gi 157414635 844 CENFVKKTRDIMENIVKLKVKLKTSSSIAKNWGDLK 879
gi 15791706  844 CENFVKKTRDIMENIVKLKVKLKTSSSIAKNWGDLK 879
gi 32266816  877 AHIYAQEAAQIMNHIYELEVPLKCGISIGKNWAELK 912
gi 152990932 853 AQELAEEFKQIMQTIHPLNVPIECSVQIARNWGDLK 888
gi 152992904 863 VEKISKRFVHVMEHIWELEVPLVCSVSVGDSWGELK 898
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap